Recombinant Viscum album Viscotoxin-A2 (THI2.3)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P32880
Gene Names: THI2.3
Alternative Name(s):
Abbreviation: Recombinant Viscum album THI2.3 protein
Organism: Viscum album (European mistletoe)
Source: E.coli
Expression Region: 1-46aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK
MW: 17.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.
Reference: "Comparative membrane interaction study of viscotoxins A3, A2 and B from mistletoe (Viscum album) and connections with their structures." Coulon A., Mosbah A., Lopez A., Sautereau A.-M., Schaller G., Urech K., Rouge P., Darbon H. Biochem. J. 374: 71-78(2003)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Recombinant Viscum album Viscotoxin-A2 (THI2.3)
Recombinant Viscum album Viscotoxin-A2 (THI2.3)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P32880
Gene Names: THI2.3
Alternative Name(s):
Abbreviation: Recombinant Viscum album THI2.3 protein
Organism: Viscum album (European mistletoe)
Source: E.coli
Expression Region: 1-46aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK
MW: 17.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.
Reference: "Comparative membrane interaction study of viscotoxins A3, A2 and B from mistletoe (Viscum album) and connections with their structures." Coulon A., Mosbah A., Lopez A., Sautereau A.-M., Schaller G., Urech K., Rouge P., Darbon H. Biochem. J. 374: 71-78(2003)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P32880
Gene Names: THI2.3
Alternative Name(s):
Abbreviation: Recombinant Viscum album THI2.3 protein
Organism: Viscum album (European mistletoe)
Source: E.coli
Expression Region: 1-46aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK
MW: 17.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.
Reference: "Comparative membrane interaction study of viscotoxins A3, A2 and B from mistletoe (Viscum album) and connections with their structures." Coulon A., Mosbah A., Lopez A., Sautereau A.-M., Schaller G., Urech K., Rouge P., Darbon H. Biochem. J. 374: 71-78(2003)
Function:
