HomeStore

Recombinant Vaccinia virus Protein E6 (VACWR062), partial

Product image 1

Recombinant Vaccinia virus Protein E6 (VACWR062), partial

Recombinant Vaccinia virus Protein E6 (VACWR062), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P21607

Gene Names: VACWR062

Alternative Name(s):

Abbreviation: Recombinant Vaccinia virus VACWR062 protein, partial

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Source: E.coli

Expression Region: 180-429aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: IWAYLSKKDTGIEFADNDRQDIYTLFQQTGRIVHSNLTETFRDYIFPGDKTSYWVWLNESIANDADIVLNRHAITMYDKILSYIYSEIKQGRVNKNMLKLVYIFEPEKDIRELLLEIIYDIPGDILSIIDAKNDDWKKYFISFYKANFINGNTFISDRTFNEDLFRVVVQIDPEYFDNERIMSLFSTSAADIKRFDELDINNSYISNIIYEVNDITLDTMDDMKKCQIFNEDTSYYVKEYNTYLFLHESD

MW: 42.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Late protein which plays an essential role in virion assembly. Participates in the correct localization and aggregation of the viral core proteins.

Reference: "The vaccinia virus E6 protein influences virion protein localization during virus assembly." Condit R.C., Moussatche N. Virology 482: 147-156(2015)

Function:

$898.01
Recombinant Vaccinia virus Protein E6 (VACWR062), partial
$898.01

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P21607

Gene Names: VACWR062

Alternative Name(s):

Abbreviation: Recombinant Vaccinia virus VACWR062 protein, partial

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Source: E.coli

Expression Region: 180-429aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: IWAYLSKKDTGIEFADNDRQDIYTLFQQTGRIVHSNLTETFRDYIFPGDKTSYWVWLNESIANDADIVLNRHAITMYDKILSYIYSEIKQGRVNKNMLKLVYIFEPEKDIRELLLEIIYDIPGDILSIIDAKNDDWKKYFISFYKANFINGNTFISDRTFNEDLFRVVVQIDPEYFDNERIMSLFSTSAADIKRFDELDINNSYISNIIYEVNDITLDTMDDMKKCQIFNEDTSYYVKEYNTYLFLHESD

MW: 42.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Late protein which plays an essential role in virion assembly. Participates in the correct localization and aggregation of the viral core proteins.

Reference: "The vaccinia virus E6 protein influences virion protein localization during virus assembly." Condit R.C., Moussatche N. Virology 482: 147-156(2015)

Function: