Recombinant Takifugu pardalis Saxitoxin and tetrodotoxin-binding protein 1 (psbp1)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Epigenetics and Nuclear Signaling
Uniprot ID: Q90WJ7
Gene Names: psbp1
Alternative Name(s):
Abbreviation: Recombinant Takifugu pardalis psbp1 protein
Organism: Takifugu pardalis (Panther puffer) (Tetraodon pardalis)
Source: E.coli
Expression Region: 21-391aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: APAPEECHKLTKPVTKADVQSVSGDWVLVWSVANTTERWICENLTSSYVEFKLHSDIIEYTERNLFLGNSCISFYSNLSASTEKQQQFSLNNLQMEEKGVVRPFNDNGTVKFFETCVDCLSMEYSGDIGRFLLIYRRDGVHQNVEVLKAAQDESQKLAECLGFSIDEPFIYDGVSDFCHKKSPEECHKLTKPVTKADVQSVSGDWVLVWSIDENSTISDDWKKLKTSYVEQRVDSGVIRFTERNMLKNNSCMTFKTNMTAGPESQNTFIYTSGKMEENGVVTVLDENGTVKFFETCADCLSMEYSGFFGHFLLIYRRDGVHQNVEVLKAAQDESQKLAECLGFSIDEPFIYDGVSDFCHKKSSPEVKPEQD
MW: 49.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Binds both saxitoxin and tetradotoxin. May play a role in toxin accumulation and/or excretion.
Reference: "Purification, characterization, and cDNA cloning of a novel soluble saxitoxin and tetrodotoxin binding protein from plasma of the puffer fish, Fugu pardalis." Yotsu-Yamashita M., Sugimoto A., Terakawa T., Shoji Y., Miyazawa T., Yasumoto T. Eur. J. Biochem. 268: 5937-5946(2001)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Takifugu pardalis Saxitoxin and tetrodotoxin-binding protein 1 (psbp1)
Recombinant Takifugu pardalis Saxitoxin and tetrodotoxin-binding protein 1 (psbp1)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Epigenetics and Nuclear Signaling
Uniprot ID: Q90WJ7
Gene Names: psbp1
Alternative Name(s):
Abbreviation: Recombinant Takifugu pardalis psbp1 protein
Organism: Takifugu pardalis (Panther puffer) (Tetraodon pardalis)
Source: E.coli
Expression Region: 21-391aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: APAPEECHKLTKPVTKADVQSVSGDWVLVWSVANTTERWICENLTSSYVEFKLHSDIIEYTERNLFLGNSCISFYSNLSASTEKQQQFSLNNLQMEEKGVVRPFNDNGTVKFFETCVDCLSMEYSGDIGRFLLIYRRDGVHQNVEVLKAAQDESQKLAECLGFSIDEPFIYDGVSDFCHKKSPEECHKLTKPVTKADVQSVSGDWVLVWSIDENSTISDDWKKLKTSYVEQRVDSGVIRFTERNMLKNNSCMTFKTNMTAGPESQNTFIYTSGKMEENGVVTVLDENGTVKFFETCADCLSMEYSGFFGHFLLIYRRDGVHQNVEVLKAAQDESQKLAECLGFSIDEPFIYDGVSDFCHKKSSPEVKPEQD
MW: 49.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Binds both saxitoxin and tetradotoxin. May play a role in toxin accumulation and/or excretion.
Reference: "Purification, characterization, and cDNA cloning of a novel soluble saxitoxin and tetrodotoxin binding protein from plasma of the puffer fish, Fugu pardalis." Yotsu-Yamashita M., Sugimoto A., Terakawa T., Shoji Y., Miyazawa T., Yasumoto T. Eur. J. Biochem. 268: 5937-5946(2001)
Function:
Original: $619.51
-70%$619.51
$185.85Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Epigenetics and Nuclear Signaling
Uniprot ID: Q90WJ7
Gene Names: psbp1
Alternative Name(s):
Abbreviation: Recombinant Takifugu pardalis psbp1 protein
Organism: Takifugu pardalis (Panther puffer) (Tetraodon pardalis)
Source: E.coli
Expression Region: 21-391aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: APAPEECHKLTKPVTKADVQSVSGDWVLVWSVANTTERWICENLTSSYVEFKLHSDIIEYTERNLFLGNSCISFYSNLSASTEKQQQFSLNNLQMEEKGVVRPFNDNGTVKFFETCVDCLSMEYSGDIGRFLLIYRRDGVHQNVEVLKAAQDESQKLAECLGFSIDEPFIYDGVSDFCHKKSPEECHKLTKPVTKADVQSVSGDWVLVWSIDENSTISDDWKKLKTSYVEQRVDSGVIRFTERNMLKNNSCMTFKTNMTAGPESQNTFIYTSGKMEENGVVTVLDENGTVKFFETCADCLSMEYSGFFGHFLLIYRRDGVHQNVEVLKAAQDESQKLAECLGFSIDEPFIYDGVSDFCHKKSSPEVKPEQD
MW: 49.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Binds both saxitoxin and tetradotoxin. May play a role in toxin accumulation and/or excretion.
Reference: "Purification, characterization, and cDNA cloning of a novel soluble saxitoxin and tetrodotoxin binding protein from plasma of the puffer fish, Fugu pardalis." Yotsu-Yamashita M., Sugimoto A., Terakawa T., Shoji Y., Miyazawa T., Yasumoto T. Eur. J. Biochem. 268: 5937-5946(2001)
Function:











