HomeStore

Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)

Product image 1

Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)

Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: B1XPT3

Gene Names: mtnB

Alternative Name(s): (MTRu-1-P dehydratase)

Abbreviation: Recombinant Synechococcus sp. mtnB protein

Organism: Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Source: E.coli

Expression Region: 1-212aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MSLENQTQKERLCAVIRQLHTQGKSPATSTNYSFLDEDQVIFVSRSGVDKSQFQPEDFIAVDTMGLPLPPDEGIKPSAETLIHCFIYQNFPGITCVLHTHSVAATLLSGIFAAKQAVTFSGYEVIKGIAGQTTHETAIALPIFANDQDMKSFCQQLAQRQEELNNYGFLIAKHGLYAWGETMAIAKRHLEVWEFMLECELEQLKITPPLAAR

MW: 31.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P).

Reference:

Function:

$9,582,980.47
Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)
$9,582,980.47

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: B1XPT3

Gene Names: mtnB

Alternative Name(s): (MTRu-1-P dehydratase)

Abbreviation: Recombinant Synechococcus sp. mtnB protein

Organism: Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Source: E.coli

Expression Region: 1-212aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MSLENQTQKERLCAVIRQLHTQGKSPATSTNYSFLDEDQVIFVSRSGVDKSQFQPEDFIAVDTMGLPLPPDEGIKPSAETLIHCFIYQNFPGITCVLHTHSVAATLLSGIFAAKQAVTFSGYEVIKGIAGQTTHETAIALPIFANDQDMKSFCQQLAQRQEELNNYGFLIAKHGLYAWGETMAIAKRHLEVWEFMLECELEQLKITPPLAAR

MW: 31.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P).

Reference:

Function: