HomeStore

Recombinant Staphylococcus aureus Type VII secretion system accessory factor EsaB (esaB)

Product image 1

Recombinant Staphylococcus aureus Type VII secretion system accessory factor EsaB (esaB)

Recombinant Staphylococcus aureus Type VII secretion system accessory factor EsaB (esaB)

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P0C050

Gene Names: esaB

Alternative Name(s):

Abbreviation: Recombinant Staphylococcus aureus esaB protein

Organism: Staphylococcus aureus (strain Newman)

Source: E.coli

Expression Region: 1-80aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL

MW: 16.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Seems to regulate secreted factors that contribute to the establishment of persistent infections in the host. Negative regulator of EsxC. Not necessary for the production and secretion of EsxA or EsxB.

Reference: "EsaC substrate for the ESAT-6 secretion pathway and its role in persistent infections of Staphylococcus aureus." Burts M.L., DeDent A.C., Missiakas D.M. Mol. Microbiol. 69: 736-746(2008)

Function:

$619.51
Recombinant Staphylococcus aureus Type VII secretion system accessory factor EsaB (esaB)
$619.51

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P0C050

Gene Names: esaB

Alternative Name(s):

Abbreviation: Recombinant Staphylococcus aureus esaB protein

Organism: Staphylococcus aureus (strain Newman)

Source: E.coli

Expression Region: 1-80aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL

MW: 16.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Seems to regulate secreted factors that contribute to the establishment of persistent infections in the host. Negative regulator of EsxC. Not necessary for the production and secretion of EsxA or EsxB.

Reference: "EsaC substrate for the ESAT-6 secretion pathway and its role in persistent infections of Staphylococcus aureus." Burts M.L., DeDent A.C., Missiakas D.M. Mol. Microbiol. 69: 736-746(2008)

Function: