Recombinant Staphylococcus aureus Type VII secretion system accessory factor EsaB (esaB)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P0C050
Gene Names: esaB
Alternative Name(s):
Abbreviation: Recombinant Staphylococcus aureus esaB protein
Organism: Staphylococcus aureus (strain Newman)
Source: E.coli
Expression Region: 1-80aa
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL
MW: 16.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Seems to regulate secreted factors that contribute to the establishment of persistent infections in the host. Negative regulator of EsxC. Not necessary for the production and secretion of EsxA or EsxB.
Reference: "EsaC substrate for the ESAT-6 secretion pathway and its role in persistent infections of Staphylococcus aureus." Burts M.L., DeDent A.C., Missiakas D.M. Mol. Microbiol. 69: 736-746(2008)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Staphylococcus aureus Type VII secretion system accessory factor EsaB (esaB)
Recombinant Staphylococcus aureus Type VII secretion system accessory factor EsaB (esaB)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P0C050
Gene Names: esaB
Alternative Name(s):
Abbreviation: Recombinant Staphylococcus aureus esaB protein
Organism: Staphylococcus aureus (strain Newman)
Source: E.coli
Expression Region: 1-80aa
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL
MW: 16.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Seems to regulate secreted factors that contribute to the establishment of persistent infections in the host. Negative regulator of EsxC. Not necessary for the production and secretion of EsxA or EsxB.
Reference: "EsaC substrate for the ESAT-6 secretion pathway and its role in persistent infections of Staphylococcus aureus." Burts M.L., DeDent A.C., Missiakas D.M. Mol. Microbiol. 69: 736-746(2008)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P0C050
Gene Names: esaB
Alternative Name(s):
Abbreviation: Recombinant Staphylococcus aureus esaB protein
Organism: Staphylococcus aureus (strain Newman)
Source: E.coli
Expression Region: 1-80aa
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL
MW: 16.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Seems to regulate secreted factors that contribute to the establishment of persistent infections in the host. Negative regulator of EsxC. Not necessary for the production and secretion of EsxA or EsxB.
Reference: "EsaC substrate for the ESAT-6 secretion pathway and its role in persistent infections of Staphylococcus aureus." Burts M.L., DeDent A.C., Missiakas D.M. Mol. Microbiol. 69: 736-746(2008)
Function:











