Recombinant Staphylococcus aureus Sortase A (srtA) (P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Microbiology
Uniprot ID: Q2FV99
Gene Names: srtA
Alternative Name(s): Surface protein sorting A
Abbreviation: Recombinant Staphylococcus aureus srtA protein, partial
Organism: Staphylococcus aureus (strain NCTC 8325)
Source: Yeast
Expression Region: 25-206aa(P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R)
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAEENESLDDQNISIAGHTFIGRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVGVLDEQKGKDKQLTLITCDDLNRETGVWETRKIFVATEVK
MW: 22.0 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Transpeptidase that anchors surface proteins to the cell wall . Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Recombinant Staphylococcus aureus Sortase A (srtA) (P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R), partial
Recombinant Staphylococcus aureus Sortase A (srtA) (P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Microbiology
Uniprot ID: Q2FV99
Gene Names: srtA
Alternative Name(s): Surface protein sorting A
Abbreviation: Recombinant Staphylococcus aureus srtA protein, partial
Organism: Staphylococcus aureus (strain NCTC 8325)
Source: Yeast
Expression Region: 25-206aa(P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R)
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAEENESLDDQNISIAGHTFIGRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVGVLDEQKGKDKQLTLITCDDLNRETGVWETRKIFVATEVK
MW: 22.0 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Transpeptidase that anchors surface proteins to the cell wall . Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal.
Reference:
Function:
Original: $11,506,098.07
-70%$11,506,098.07
$3,451,829.42Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Microbiology
Uniprot ID: Q2FV99
Gene Names: srtA
Alternative Name(s): Surface protein sorting A
Abbreviation: Recombinant Staphylococcus aureus srtA protein, partial
Organism: Staphylococcus aureus (strain NCTC 8325)
Source: Yeast
Expression Region: 25-206aa(P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R)
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAEENESLDDQNISIAGHTFIGRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVGVLDEQKGKDKQLTLITCDDLNRETGVWETRKIFVATEVK
MW: 22.0 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Transpeptidase that anchors surface proteins to the cell wall . Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal.
Reference:
Function:
