Recombinant Shigella flexneri Phosphatidylglycerophosphatase B (pgpB), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P0A926
Gene Names: pgpB
Alternative Name(s): Diacylglycerol pyrophosphate phosphatase;DGPP phosphatase;Phosphatidate phosphatase;Undecaprenyl pyrophosphate phosphatase;Undecaprenyl-diphosphatase
Abbreviation: Recombinant Shigella flexneri pgpB protein, partial
Organism: Shigella flexneri
Source: E.coli
Expression Region: 95-161aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: WIKDKVQEPRPFVIWLEKTHHIPVDEFYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFPS
MW: 15 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Catalyzes the dephosphorylation of diacylglycerol diphosphate (DGPP) to phosphatidate (PA) and the subsequent dephosphorylation of PA to diacylglycerol (DAG). Also has undecaprenyl pyrophosphate phosphatase activity, required for the biosynthesis of the lipid carrier undecaprenyl phosphate. Can also use lysophosphatidic acid (LPA) and phosphatidylglycerophosphate as substrates. The pattern of activities varies according to subcellular location, PGP phosphatase activity is higher in the cytoplasmic membrane, whereas PA and LPA phosphatase activities are higher in the outer membrane. Activity is independent of a divalent cation ion and insensitive to inhibition by N-ethylmaleimide.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Shigella flexneri Phosphatidylglycerophosphatase B (pgpB), partial
Recombinant Shigella flexneri Phosphatidylglycerophosphatase B (pgpB), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P0A926
Gene Names: pgpB
Alternative Name(s): Diacylglycerol pyrophosphate phosphatase;DGPP phosphatase;Phosphatidate phosphatase;Undecaprenyl pyrophosphate phosphatase;Undecaprenyl-diphosphatase
Abbreviation: Recombinant Shigella flexneri pgpB protein, partial
Organism: Shigella flexneri
Source: E.coli
Expression Region: 95-161aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: WIKDKVQEPRPFVIWLEKTHHIPVDEFYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFPS
MW: 15 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Catalyzes the dephosphorylation of diacylglycerol diphosphate (DGPP) to phosphatidate (PA) and the subsequent dephosphorylation of PA to diacylglycerol (DAG). Also has undecaprenyl pyrophosphate phosphatase activity, required for the biosynthesis of the lipid carrier undecaprenyl phosphate. Can also use lysophosphatidic acid (LPA) and phosphatidylglycerophosphate as substrates. The pattern of activities varies according to subcellular location, PGP phosphatase activity is higher in the cytoplasmic membrane, whereas PA and LPA phosphatase activities are higher in the outer membrane. Activity is independent of a divalent cation ion and insensitive to inhibition by N-ethylmaleimide.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P0A926
Gene Names: pgpB
Alternative Name(s): Diacylglycerol pyrophosphate phosphatase;DGPP phosphatase;Phosphatidate phosphatase;Undecaprenyl pyrophosphate phosphatase;Undecaprenyl-diphosphatase
Abbreviation: Recombinant Shigella flexneri pgpB protein, partial
Organism: Shigella flexneri
Source: E.coli
Expression Region: 95-161aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: WIKDKVQEPRPFVIWLEKTHHIPVDEFYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFPS
MW: 15 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Catalyzes the dephosphorylation of diacylglycerol diphosphate (DGPP) to phosphatidate (PA) and the subsequent dephosphorylation of PA to diacylglycerol (DAG). Also has undecaprenyl pyrophosphate phosphatase activity, required for the biosynthesis of the lipid carrier undecaprenyl phosphate. Can also use lysophosphatidic acid (LPA) and phosphatidylglycerophosphate as substrates. The pattern of activities varies according to subcellular location, PGP phosphatase activity is higher in the cytoplasmic membrane, whereas PA and LPA phosphatase activities are higher in the outer membrane. Activity is independent of a divalent cation ion and insensitive to inhibition by N-ethylmaleimide.
Reference:
Function:











