HomeStore

Recombinant Rat Matrilysin (Mmp7)

Product image 1

Recombinant Rat Matrilysin (Mmp7)

Recombinant Rat Matrilysin (Mmp7)

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P50280

Gene Names: Mmp7

Alternative Name(s): Matrin;Matrix metalloproteinase-7;MMP-7;Pump-1 protease;Uterine metalloproteinase

Abbreviation: Recombinant Rat Mmp7 protein

Organism: Rattus norvegicus (Rat)

Source: E.coli

Expression Region: 98-267aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL

MW: 25.0 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.

Reference:

Function:

$2,874,894.14

Original: $9,582,980.47

-70%
Recombinant Rat Matrilysin (Mmp7)

$9,582,980.47

$2,874,894.14

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P50280

Gene Names: Mmp7

Alternative Name(s): Matrin;Matrix metalloproteinase-7;MMP-7;Pump-1 protease;Uterine metalloproteinase

Abbreviation: Recombinant Rat Mmp7 protein

Organism: Rattus norvegicus (Rat)

Source: E.coli

Expression Region: 98-267aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL

MW: 25.0 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.

Reference:

Function: