Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q6MG58
Gene Names: Ly6g6d
Alternative Name(s):
Abbreviation: Recombinant Rat Ly6g6d protein (Active)
Organism: Rattus norvegicus (Rat)
Source: Yeast
Expression Region: 20-108aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
MW: 11.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/mL can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4HU). The EC50 is 6.238-7.258 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q6MG58
Gene Names: Ly6g6d
Alternative Name(s):
Abbreviation: Recombinant Rat Ly6g6d protein (Active)
Organism: Rattus norvegicus (Rat)
Source: Yeast
Expression Region: 20-108aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
MW: 11.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/mL can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4HU). The EC50 is 6.238-7.258 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q6MG58
Gene Names: Ly6g6d
Alternative Name(s):
Abbreviation: Recombinant Rat Ly6g6d protein (Active)
Organism: Rattus norvegicus (Rat)
Source: Yeast
Expression Region: 20-108aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
MW: 11.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/mL can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4HU). The EC50 is 6.238-7.258 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:











