Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cardiovascular
Uniprot ID: P32301
Gene Names: Glp1r
Alternative Name(s): Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r; Glpr
Abbreviation: Recombinant Rat Glp1r protein, partial (Active)
Organism: Rattus norvegicus (Rat)
Source: Mammalian cell
Expression Region: 22-139aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEE
MW: 14.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 8.630-10.66 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Reference: Adenylyl cyclase 8 is central to glucagon-like peptide 1 signalling and effects of chronically elevated glucose in rat and human pancreatic beta cells. Roger B., Papin J., Vacher P., Raoux M., Mulot A., Dubois M., Kerr-Conte J., Voy B.H., Pattou F., Lang J. Diabetologia 54: 390-402 (2011)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial (Active)
Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cardiovascular
Uniprot ID: P32301
Gene Names: Glp1r
Alternative Name(s): Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r; Glpr
Abbreviation: Recombinant Rat Glp1r protein, partial (Active)
Organism: Rattus norvegicus (Rat)
Source: Mammalian cell
Expression Region: 22-139aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEE
MW: 14.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 8.630-10.66 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Reference: Adenylyl cyclase 8 is central to glucagon-like peptide 1 signalling and effects of chronically elevated glucose in rat and human pancreatic beta cells. Roger B., Papin J., Vacher P., Raoux M., Mulot A., Dubois M., Kerr-Conte J., Voy B.H., Pattou F., Lang J. Diabetologia 54: 390-402 (2011)
Function:
Original: $66,229.45
-70%$66,229.45
$19,868.83Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cardiovascular
Uniprot ID: P32301
Gene Names: Glp1r
Alternative Name(s): Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r; Glpr
Abbreviation: Recombinant Rat Glp1r protein, partial (Active)
Organism: Rattus norvegicus (Rat)
Source: Mammalian cell
Expression Region: 22-139aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEE
MW: 14.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 8.630-10.66 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Reference: Adenylyl cyclase 8 is central to glucagon-like peptide 1 signalling and effects of chronically elevated glucose in rat and human pancreatic beta cells. Roger B., Papin J., Vacher P., Raoux M., Mulot A., Dubois M., Kerr-Conte J., Voy B.H., Pattou F., Lang J. Diabetologia 54: 390-402 (2011)
Function:











