Recombinant Raphanus sativus Late embryogenesis abundant protein, partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P21298
Gene Names: N/A
Alternative Name(s): (Protein LEA)
Abbreviation: Recombinant Raphanus sativus Late embryogenesis abundant protein, partial
Organism: Raphanus sativus (Radish) (Raphanus raphanistrum var. sativus)
Source: E.coli
Expression Region: 1-48aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: MADLKDERGNPIHLTDAYGNPVQLSDEFGNPMHITGVASSAPQYKDSV
MW: 20.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: LEA protein are late embryogenesis abundant in higher plant seed embryos. There are two subsets of LEA proteins (5a, and 5b), the first ones are expressed when the cotyledon weight reach 80 mg and the second set are expressed above 100 mg. The function of those proteins is not known.
Reference: "Nucleotide sequence of a radish cDNA clone coding for a late embryogenesis abundant (LEA) protein." Raynal M., Gaubier P., Grellet F., Delseny M. Nucleic Acids Res. 18: 6132-6132(1990)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Raphanus sativus Late embryogenesis abundant protein, partial
Recombinant Raphanus sativus Late embryogenesis abundant protein, partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P21298
Gene Names: N/A
Alternative Name(s): (Protein LEA)
Abbreviation: Recombinant Raphanus sativus Late embryogenesis abundant protein, partial
Organism: Raphanus sativus (Radish) (Raphanus raphanistrum var. sativus)
Source: E.coli
Expression Region: 1-48aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: MADLKDERGNPIHLTDAYGNPVQLSDEFGNPMHITGVASSAPQYKDSV
MW: 20.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: LEA protein are late embryogenesis abundant in higher plant seed embryos. There are two subsets of LEA proteins (5a, and 5b), the first ones are expressed when the cotyledon weight reach 80 mg and the second set are expressed above 100 mg. The function of those proteins is not known.
Reference: "Nucleotide sequence of a radish cDNA clone coding for a late embryogenesis abundant (LEA) protein." Raynal M., Gaubier P., Grellet F., Delseny M. Nucleic Acids Res. 18: 6132-6132(1990)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P21298
Gene Names: N/A
Alternative Name(s): (Protein LEA)
Abbreviation: Recombinant Raphanus sativus Late embryogenesis abundant protein, partial
Organism: Raphanus sativus (Radish) (Raphanus raphanistrum var. sativus)
Source: E.coli
Expression Region: 1-48aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: MADLKDERGNPIHLTDAYGNPVQLSDEFGNPMHITGVASSAPQYKDSV
MW: 20.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: LEA protein are late embryogenesis abundant in higher plant seed embryos. There are two subsets of LEA proteins (5a, and 5b), the first ones are expressed when the cotyledon weight reach 80 mg and the second set are expressed above 100 mg. The function of those proteins is not known.
Reference: "Nucleotide sequence of a radish cDNA clone coding for a late embryogenesis abundant (LEA) protein." Raynal M., Gaubier P., Grellet F., Delseny M. Nucleic Acids Res. 18: 6132-6132(1990)
Function:











