Recombinant Rabbit B (0,+)-type amino acid transporter 1 (SLC7A9), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Metabolism
Uniprot ID: Q9N1R6
Gene Names: SLC7A9
Alternative Name(s): 4F2-LC6;Glycoprotein-associated amino acid transporter b0,+AT1;Solute carrier family 7 member 9
Abbreviation: Recombinant Rabbit SLC7A9 protein, partial
Organism: Oryctolagus cuniculus (Rabbit)
Source: Yeast
Expression Region: 451-487aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: YFLFVYYKFEWAQKISKPITMHLQMLMEVVPPEPDPK
MW: 6.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mediates the electrogenic exchange between cationic amino acids and neutral amino acids, with a stoichiometry of 1: 1 . Has system b(0,+)-like activity with high affinity for extracellular cationic amino acids and L-cystine and lower affinity for intracellular neutral amino acids . Substrate exchange is driven by high concentration of intracellular neutral amino acids and the intracellular reduction of L-cystine to L-cysteine . Required for reabsorption of L-cystine and dibasic amino acids across the brush border membrane in renal proximal tubules.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Rabbit B (0,+)-type amino acid transporter 1 (SLC7A9), partial
Recombinant Rabbit B (0,+)-type amino acid transporter 1 (SLC7A9), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Metabolism
Uniprot ID: Q9N1R6
Gene Names: SLC7A9
Alternative Name(s): 4F2-LC6;Glycoprotein-associated amino acid transporter b0,+AT1;Solute carrier family 7 member 9
Abbreviation: Recombinant Rabbit SLC7A9 protein, partial
Organism: Oryctolagus cuniculus (Rabbit)
Source: Yeast
Expression Region: 451-487aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: YFLFVYYKFEWAQKISKPITMHLQMLMEVVPPEPDPK
MW: 6.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mediates the electrogenic exchange between cationic amino acids and neutral amino acids, with a stoichiometry of 1: 1 . Has system b(0,+)-like activity with high affinity for extracellular cationic amino acids and L-cystine and lower affinity for intracellular neutral amino acids . Substrate exchange is driven by high concentration of intracellular neutral amino acids and the intracellular reduction of L-cystine to L-cysteine . Required for reabsorption of L-cystine and dibasic amino acids across the brush border membrane in renal proximal tubules.
Reference:
Function:
Original: $9,549,648.37
-70%$9,549,648.37
$2,864,894.51Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Metabolism
Uniprot ID: Q9N1R6
Gene Names: SLC7A9
Alternative Name(s): 4F2-LC6;Glycoprotein-associated amino acid transporter b0,+AT1;Solute carrier family 7 member 9
Abbreviation: Recombinant Rabbit SLC7A9 protein, partial
Organism: Oryctolagus cuniculus (Rabbit)
Source: Yeast
Expression Region: 451-487aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: YFLFVYYKFEWAQKISKPITMHLQMLMEVVPPEPDPK
MW: 6.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mediates the electrogenic exchange between cationic amino acids and neutral amino acids, with a stoichiometry of 1: 1 . Has system b(0,+)-like activity with high affinity for extracellular cationic amino acids and L-cystine and lower affinity for intracellular neutral amino acids . Substrate exchange is driven by high concentration of intracellular neutral amino acids and the intracellular reduction of L-cystine to L-cysteine . Required for reabsorption of L-cystine and dibasic amino acids across the brush border membrane in renal proximal tubules.
Reference:
Function:











