HomeStore

Recombinant Porcine reproductive and respiratory syndrome viru Glycoprotein 2a (GP2a), partial

Product image 1

Recombinant Porcine reproductive and respiratory syndrome viru Glycoprotein 2a (GP2a), partial

Recombinant Porcine reproductive and respiratory syndrome viru Glycoprotein 2a (GP2a), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A0MD30

Gene Names: GP2a

Alternative Name(s): Protein GP2a;GP2

Abbreviation: Recombinant Porcine reproductive and respiratory syndrome virus GP2a protein, partial

Organism: Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)

Source: Mammalian cell

Expression Region: 36-207aa

Protein Length: Partial

Tag Info: C-terminal Twin-Strep-tagged

Target Protein Sequence: LGSPSQDGYWSFFSEWFAPRFSVRALPFTLPNYRRSYESLLPNCRPDVPQFAFKHPLGILWHMRVSHLIDEMVSRRIYQTMEHSGQAAWKYVVGEATLTKLSKLDIVTHFQHLAAVEADSCRFLSSRLVMLKNLAVGNVSLQYNTTLDRVELIFPTPGTRPKLTDFRQWLIS

MW: 22.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Minor envelope protein. Along with GP4, serves as the viral attachment protein responsible for mediating interactions with CD163 thereby playing a role in virus entry into susceptible host cells.1 Publication

Reference:

Function:

$7,792,466.69
Recombinant Porcine reproductive and respiratory syndrome viru Glycoprotein 2a (GP2a), partial
$7,792,466.69

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A0MD30

Gene Names: GP2a

Alternative Name(s): Protein GP2a;GP2

Abbreviation: Recombinant Porcine reproductive and respiratory syndrome virus GP2a protein, partial

Organism: Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)

Source: Mammalian cell

Expression Region: 36-207aa

Protein Length: Partial

Tag Info: C-terminal Twin-Strep-tagged

Target Protein Sequence: LGSPSQDGYWSFFSEWFAPRFSVRALPFTLPNYRRSYESLLPNCRPDVPQFAFKHPLGILWHMRVSHLIDEMVSRRIYQTMEHSGQAAWKYVVGEATLTKLSKLDIVTHFQHLAAVEADSCRFLSSRLVMLKNLAVGNVSLQYNTTLDRVELIFPTPGTRPKLTDFRQWLIS

MW: 22.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Minor envelope protein. Along with GP4, serves as the viral attachment protein responsible for mediating interactions with CD163 thereby playing a role in virus entry into susceptible host cells.1 Publication

Reference:

Function: