HomeStore

Recombinant Pig Tenascin (TNC), partial

Product image 1

Recombinant Pig Tenascin (TNC), partial

Recombinant Pig Tenascin (TNC), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Neuroscience

Uniprot ID: Q29116

Gene Names: TNC

Alternative Name(s): TN;Cytotactin;GMEM;GP 150-225;Glioma-associated-extracellular matrix antigen;Hexabrachion;JI;Myotendinous antigen;Neuronectin;P230;Tenascin-C;TN-C

Abbreviation: Recombinant Pig TNC protein, partial

Organism: Sus scrofa (Pig)

Source: Yeast

Expression Region: 1520-1735aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: GLLYPFPRDCSQAMLNGDTTSGLYTIYVNNDKAQKLEVFCDMTSDSGGWIVFLRRKNGREDFYRNWKAYAAGFGDLKEEFWLGLDALSKITAQGQYELRVDLRDHGETAYAVYDRFSVGDARTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNSHSQGVNWFHWKGHEYSIQFAEMKLRPSN

MW: 26.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells.

Reference:

Function:

$562.15

Original: $1,873.84

-70%
Recombinant Pig Tenascin (TNC), partial

$1,873.84

$562.15

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Neuroscience

Uniprot ID: Q29116

Gene Names: TNC

Alternative Name(s): TN;Cytotactin;GMEM;GP 150-225;Glioma-associated-extracellular matrix antigen;Hexabrachion;JI;Myotendinous antigen;Neuronectin;P230;Tenascin-C;TN-C

Abbreviation: Recombinant Pig TNC protein, partial

Organism: Sus scrofa (Pig)

Source: Yeast

Expression Region: 1520-1735aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: GLLYPFPRDCSQAMLNGDTTSGLYTIYVNNDKAQKLEVFCDMTSDSGGWIVFLRRKNGREDFYRNWKAYAAGFGDLKEEFWLGLDALSKITAQGQYELRVDLRDHGETAYAVYDRFSVGDARTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNSHSQGVNWFHWKGHEYSIQFAEMKLRPSN

MW: 26.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells.

Reference:

Function: