Recombinant Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q7YRN2
Gene Names: CD3E
Alternative Name(s): (CD antigen CD3e)
Abbreviation: Recombinant Pig CD3E protein, partial
Organism: Sus scrofa (Pig)
Source: E.coli
Expression Region: 22-116aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: QEDIERPDEDTQKTFKVSISGDKVELTCPEDPESEKMTWKRNDMQIYESYDNYMLLESFSEVENSGYYTCTVGEKTSHRLYLKARVCENCVEVDL
MW: 15.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Reference: "Cloning and sequencing of porcine CD3 epsilon." Wang J., Yang H., Guo X. Submitted (JUN-2003)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Recombinant Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial
Recombinant Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q7YRN2
Gene Names: CD3E
Alternative Name(s): (CD antigen CD3e)
Abbreviation: Recombinant Pig CD3E protein, partial
Organism: Sus scrofa (Pig)
Source: E.coli
Expression Region: 22-116aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: QEDIERPDEDTQKTFKVSISGDKVELTCPEDPESEKMTWKRNDMQIYESYDNYMLLESFSEVENSGYYTCTVGEKTSHRLYLKARVCENCVEVDL
MW: 15.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Reference: "Cloning and sequencing of porcine CD3 epsilon." Wang J., Yang H., Guo X. Submitted (JUN-2003)
Function:
Original: $70,939.42
-70%$70,939.42
$21,281.83Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q7YRN2
Gene Names: CD3E
Alternative Name(s): (CD antigen CD3e)
Abbreviation: Recombinant Pig CD3E protein, partial
Organism: Sus scrofa (Pig)
Source: E.coli
Expression Region: 22-116aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: QEDIERPDEDTQKTFKVSISGDKVELTCPEDPESEKMTWKRNDMQIYESYDNYMLLESFSEVENSGYYTCTVGEKTSHRLYLKARVCENCVEVDL
MW: 15.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Reference: "Cloning and sequencing of porcine CD3 epsilon." Wang J., Yang H., Guo X. Submitted (JUN-2003)
Function:
