Recombinant Naja atra Cobrotoxin
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P60770
Gene Names: N/A
Alternative Name(s): (CBT)(CBTX)(CTX)(Atratoxin)(Cobratide)(Short neurotoxin 1)
Abbreviation: Recombinant Naja atra Cobrotoxin protein
Organism: Naja atra (Chinese cobra)
Source: E.coli
Expression Region: 22-83aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
MW: 22.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Binds to muscle nicotinic acetylcholine receptor (nAChR) and inhibit acetylcholine from binding to the receptor, thereby impairing neuromuscular transmission. Has a higher toxicity than cobrotoxin-b. In vivo, when tested on rat arthritis models, shows anti-inflammation and immunosuppression effects.
Reference: "Cobrotoxin extracted from Naja atra venom relieves arthritis symptoms through anti-inflammation and immunosuppression effects in rat arthritis model." Zhu Q., Huang J., Wang S.Z., Qin Z.H., Lin F. J. Ethnopharmacol. 194: 1087-1095(2016)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Naja atra Cobrotoxin
Recombinant Naja atra Cobrotoxin
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P60770
Gene Names: N/A
Alternative Name(s): (CBT)(CBTX)(CTX)(Atratoxin)(Cobratide)(Short neurotoxin 1)
Abbreviation: Recombinant Naja atra Cobrotoxin protein
Organism: Naja atra (Chinese cobra)
Source: E.coli
Expression Region: 22-83aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
MW: 22.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Binds to muscle nicotinic acetylcholine receptor (nAChR) and inhibit acetylcholine from binding to the receptor, thereby impairing neuromuscular transmission. Has a higher toxicity than cobrotoxin-b. In vivo, when tested on rat arthritis models, shows anti-inflammation and immunosuppression effects.
Reference: "Cobrotoxin extracted from Naja atra venom relieves arthritis symptoms through anti-inflammation and immunosuppression effects in rat arthritis model." Zhu Q., Huang J., Wang S.Z., Qin Z.H., Lin F. J. Ethnopharmacol. 194: 1087-1095(2016)
Function:
Original: $898.01
-70%$898.01
$269.40Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P60770
Gene Names: N/A
Alternative Name(s): (CBT)(CBTX)(CTX)(Atratoxin)(Cobratide)(Short neurotoxin 1)
Abbreviation: Recombinant Naja atra Cobrotoxin protein
Organism: Naja atra (Chinese cobra)
Source: E.coli
Expression Region: 22-83aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
MW: 22.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Binds to muscle nicotinic acetylcholine receptor (nAChR) and inhibit acetylcholine from binding to the receptor, thereby impairing neuromuscular transmission. Has a higher toxicity than cobrotoxin-b. In vivo, when tested on rat arthritis models, shows anti-inflammation and immunosuppression effects.
Reference: "Cobrotoxin extracted from Naja atra venom relieves arthritis symptoms through anti-inflammation and immunosuppression effects in rat arthritis model." Zhu Q., Huang J., Wang S.Z., Qin Z.H., Lin F. J. Ethnopharmacol. 194: 1087-1095(2016)
Function:











