HomeStore

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

Product image 1

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9WUP1

Gene Names: Ramp3

Alternative Name(s): Ramp3

Abbreviation: Recombinant Mouse Ramp3 protein, partial

Organism: Mus musculus (Mouse)

Source: Yeast

Expression Region: 23-117aa

Protein Length: Partial of Isoform 2

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: QVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEV

MW: 12.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL), calcitonin receptor (CALCR) and G-protein coupled estrogen receptor 1 (GPER1) (PubMed: 10854696, PubMed: 23674134). Required for the transport of CALCRL and GPER1 receptors to the plasma membrane (By similarity). Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner (PubMed: 23674134). Together with CALCRL, form a receptor complex for adrenomedullin/ADM and intermedin/ADM2 (PubMed: 10854696). Together with CALCR, act as a receptor complex for amylin/IAPP (By similarity).

Reference:

Function:

$627.58

Original: $2,091.95

-70%
Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

$2,091.95

$627.58

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9WUP1

Gene Names: Ramp3

Alternative Name(s): Ramp3

Abbreviation: Recombinant Mouse Ramp3 protein, partial

Organism: Mus musculus (Mouse)

Source: Yeast

Expression Region: 23-117aa

Protein Length: Partial of Isoform 2

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: QVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEV

MW: 12.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL), calcitonin receptor (CALCR) and G-protein coupled estrogen receptor 1 (GPER1) (PubMed: 10854696, PubMed: 23674134). Required for the transport of CALCRL and GPER1 receptors to the plasma membrane (By similarity). Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner (PubMed: 23674134). Together with CALCRL, form a receptor complex for adrenomedullin/ADM and intermedin/ADM2 (PubMed: 10854696). Together with CALCR, act as a receptor complex for amylin/IAPP (By similarity).

Reference:

Function: