Recombinant Mouse Mucin 5, subtypes A and C, tracheobronchial/gastric (Muc5ac), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: E9PWB6
Gene Names: Muc5ac
Alternative Name(s): /
Abbreviation: Recombinant Mouse Muc5ac protein, partial
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 2452-2721aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: CPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVVSSSLCERCLCEVSSNPLSDVFMVSCETELCNTQCPKGSEYQAMPGQCCGKCIPKTCPFKNNSGSTYFYQPGELWAEPGNPCVTHKCEKFQDVLMVVTMKTECPKINCPQGQAQLREDGCCYDCPLPNQQKCTVHQRQQIIRQQNCSSEGPVSISYCQGNCGDSISMYSLEANKVEHTCECCQELQTSQRNVTLRCDDGSSQTFSYTQVEKCGCLGQQCHALGDTSHAES
MW: 33.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Gel-forming glycoprotein of gastric and respiratoy tract epithelia that protects the mucosa from infection and chical damage by binding to inhaled microrganisms and particles that are subsequently roved by the mucocilary syst.
Reference: Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440: 497-500(2006)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Mouse Mucin 5, subtypes A and C, tracheobronchial/gastric (Muc5ac), partial
Recombinant Mouse Mucin 5, subtypes A and C, tracheobronchial/gastric (Muc5ac), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: E9PWB6
Gene Names: Muc5ac
Alternative Name(s): /
Abbreviation: Recombinant Mouse Muc5ac protein, partial
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 2452-2721aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: CPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVVSSSLCERCLCEVSSNPLSDVFMVSCETELCNTQCPKGSEYQAMPGQCCGKCIPKTCPFKNNSGSTYFYQPGELWAEPGNPCVTHKCEKFQDVLMVVTMKTECPKINCPQGQAQLREDGCCYDCPLPNQQKCTVHQRQQIIRQQNCSSEGPVSISYCQGNCGDSISMYSLEANKVEHTCECCQELQTSQRNVTLRCDDGSSQTFSYTQVEKCGCLGQQCHALGDTSHAES
MW: 33.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Gel-forming glycoprotein of gastric and respiratoy tract epithelia that protects the mucosa from infection and chical damage by binding to inhaled microrganisms and particles that are subsequently roved by the mucocilary syst.
Reference: Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440: 497-500(2006)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: E9PWB6
Gene Names: Muc5ac
Alternative Name(s): /
Abbreviation: Recombinant Mouse Muc5ac protein, partial
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 2452-2721aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: CPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVVSSSLCERCLCEVSSNPLSDVFMVSCETELCNTQCPKGSEYQAMPGQCCGKCIPKTCPFKNNSGSTYFYQPGELWAEPGNPCVTHKCEKFQDVLMVVTMKTECPKINCPQGQAQLREDGCCYDCPLPNQQKCTVHQRQQIIRQQNCSSEGPVSISYCQGNCGDSISMYSLEANKVEHTCECCQELQTSQRNVTLRCDDGSSQTFSYTQVEKCGCLGQQCHALGDTSHAES
MW: 33.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Gel-forming glycoprotein of gastric and respiratoy tract epithelia that protects the mucosa from infection and chical damage by binding to inhaled microrganisms and particles that are subsequently roved by the mucocilary syst.
Reference: Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440: 497-500(2006)
Function:











