Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cardiovascular
Uniprot ID: P07141
Gene Names: Csf1
Alternative Name(s): Macrophage colony-stimulating factor 1; CSF-1; MCSF; Proteoglycan macrophage colony-stimulating factor; Cleaved into 2 chains Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; Csf1; Csfm
Abbreviation: Recombinant Mouse Csf1 protein, partial (Active)
Organism: Mus musculus (Mouse)
Source: Mammalian cell
Expression Region: 33-262aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
MW: 27.4 kDa
Purity: Greater than 90% as determined by SEC-HPLC. Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1 at 2 μg/mL can bind Mouse Csf1r(CSB-MP006044MO). The EC50 is 3.226-4.264 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Reference: Structure of macrophage colony stimulating factor bound to FMS: diverse signaling assemblies of class III receptor tyrosine kinases. Chen X., Liu H., Focia P.J., Shim A.H., He X. Proc. Natl. Acad. Sci. U.S.A. 105: 18267-18272 (2008)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial (Active)
Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cardiovascular
Uniprot ID: P07141
Gene Names: Csf1
Alternative Name(s): Macrophage colony-stimulating factor 1; CSF-1; MCSF; Proteoglycan macrophage colony-stimulating factor; Cleaved into 2 chains Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; Csf1; Csfm
Abbreviation: Recombinant Mouse Csf1 protein, partial (Active)
Organism: Mus musculus (Mouse)
Source: Mammalian cell
Expression Region: 33-262aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
MW: 27.4 kDa
Purity: Greater than 90% as determined by SEC-HPLC. Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1 at 2 μg/mL can bind Mouse Csf1r(CSB-MP006044MO). The EC50 is 3.226-4.264 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Reference: Structure of macrophage colony stimulating factor bound to FMS: diverse signaling assemblies of class III receptor tyrosine kinases. Chen X., Liu H., Focia P.J., Shim A.H., He X. Proc. Natl. Acad. Sci. U.S.A. 105: 18267-18272 (2008)
Function:
Original: $995.62
-70%$995.62
$298.69Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cardiovascular
Uniprot ID: P07141
Gene Names: Csf1
Alternative Name(s): Macrophage colony-stimulating factor 1; CSF-1; MCSF; Proteoglycan macrophage colony-stimulating factor; Cleaved into 2 chains Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; Csf1; Csfm
Abbreviation: Recombinant Mouse Csf1 protein, partial (Active)
Organism: Mus musculus (Mouse)
Source: Mammalian cell
Expression Region: 33-262aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
MW: 27.4 kDa
Purity: Greater than 90% as determined by SEC-HPLC. Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1 at 2 μg/mL can bind Mouse Csf1r(CSB-MP006044MO). The EC50 is 3.226-4.264 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Reference: Structure of macrophage colony stimulating factor bound to FMS: diverse signaling assemblies of class III receptor tyrosine kinases. Chen X., Liu H., Focia P.J., Shim A.H., He X. Proc. Natl. Acad. Sci. U.S.A. 105: 18267-18272 (2008)
Function:











