HomeStore

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

Product image 1

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Obesity

Uniprot ID: Q0P543

Gene Names: Gipr

Alternative Name(s): Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr

Abbreviation: Recombinant Mouse Gipr protein, partial (Active)

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 19-134aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

MW: 14.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody (CSB-RA009438MA1MO), the EC50 is 8.622-11.36 ng/ml.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May play an important role in blood sugar regulation.

Reference: "Lineage-specific biology revealed by a finished genome assembly of the mouse." Am J Physiol Endocrinol Metab 294: E61-8 (2008)

Function:

$87.81

Original: $292.71

-70%
Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

$292.71

$87.81

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Obesity

Uniprot ID: Q0P543

Gene Names: Gipr

Alternative Name(s): Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr

Abbreviation: Recombinant Mouse Gipr protein, partial (Active)

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 19-134aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

MW: 14.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody (CSB-RA009438MA1MO), the EC50 is 8.622-11.36 ng/ml.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May play an important role in blood sugar regulation.

Reference: "Lineage-specific biology revealed by a finished genome assembly of the mouse." Am J Physiol Endocrinol Metab 294: E61-8 (2008)

Function: