Recombinant Mouse CMRF35-like molecule 5 (Cd300ld), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q8VCH2
Gene Names: Cd300ld
Alternative Name(s): CLM-5;CD300 antigen like family member D;Leukocyte mono-Ig-like receptor 4;Myeloid-associated immunoglobulin-like receptor 4;MAIR-4;MAIR-IV
Abbreviation: Recombinant Mouse Cd300ld protein, partial
Organism: Mus musculus (Mouse)
Source: Yeast
Expression Region: 19-177aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: QDSVTGPEEVSGQEQGSLTVQCRYSSYWKGYKKYWCRGVPQRSCDILVETDKSEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGPDPMFKVNVNIDQAPKSSMMTTTATVLKSIQPSAENTGKEQVTQSKEVTQSRPHTRSLLSSIY
MW: 20.0 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Acts as an activating receptor in myeloid cells and mast cells. ; (Microbial infection) Acts as a functional murine norovirus (MNV) receptor. Primary determinant of MNV species tropism and is sufficient to render cells permissive to infection by MNV. Can render nonmurine mammalian cells susceptible to MNV infection.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Mouse CMRF35-like molecule 5 (Cd300ld), partial
Recombinant Mouse CMRF35-like molecule 5 (Cd300ld), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q8VCH2
Gene Names: Cd300ld
Alternative Name(s): CLM-5;CD300 antigen like family member D;Leukocyte mono-Ig-like receptor 4;Myeloid-associated immunoglobulin-like receptor 4;MAIR-4;MAIR-IV
Abbreviation: Recombinant Mouse Cd300ld protein, partial
Organism: Mus musculus (Mouse)
Source: Yeast
Expression Region: 19-177aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: QDSVTGPEEVSGQEQGSLTVQCRYSSYWKGYKKYWCRGVPQRSCDILVETDKSEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGPDPMFKVNVNIDQAPKSSMMTTTATVLKSIQPSAENTGKEQVTQSKEVTQSRPHTRSLLSSIY
MW: 20.0 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Acts as an activating receptor in myeloid cells and mast cells. ; (Microbial infection) Acts as a functional murine norovirus (MNV) receptor. Primary determinant of MNV species tropism and is sufficient to render cells permissive to infection by MNV. Can render nonmurine mammalian cells susceptible to MNV infection.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q8VCH2
Gene Names: Cd300ld
Alternative Name(s): CLM-5;CD300 antigen like family member D;Leukocyte mono-Ig-like receptor 4;Myeloid-associated immunoglobulin-like receptor 4;MAIR-4;MAIR-IV
Abbreviation: Recombinant Mouse Cd300ld protein, partial
Organism: Mus musculus (Mouse)
Source: Yeast
Expression Region: 19-177aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: QDSVTGPEEVSGQEQGSLTVQCRYSSYWKGYKKYWCRGVPQRSCDILVETDKSEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGPDPMFKVNVNIDQAPKSSMMTTTATVLKSIQPSAENTGKEQVTQSKEVTQSRPHTRSLLSSIY
MW: 20.0 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Acts as an activating receptor in myeloid cells and mast cells. ; (Microbial infection) Acts as a functional murine norovirus (MNV) receptor. Primary determinant of MNV species tropism and is sufficient to render cells permissive to infection by MNV. Can render nonmurine mammalian cells susceptible to MNV infection.
Reference:
Function:











