Recombinant Mouse CD40 ligand (Cd40lg), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cancer
Uniprot ID: P27548
Gene Names: Cd40lg
Alternative Name(s): CD40 ligand;CD40-L; T-cell antigen Gp39TNF-related activation protein (TRAP); Tumor necrosis factor ligand superfamily member 5; CD154; Cd40lg; Cd40l, Tnfsf5
Abbreviation: Recombinant Mouse Cd40lg protein, partial (Active)
Organism: Mus musculus (Mouse)
Source: Mammalian cell
Expression Region: 112-260aa
Protein Length: Partial
Tag Info: N-terminal mFc1-tagged
Target Protein Sequence: MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
MW: 42.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40(CSB-MP004936MO1) at 2 μg/mL can bind Mouse Cd40lg.The EC50 is 5.121-6.085 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching. CD40 ligand, soluble form Acts as a ligand for integrins, specifically ITGA5: ITGB1 and ITGAV: ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.
Reference: Proximity-dependent labeling identifies dendritic cells that drive the tumor-specific CD4+ T cell response. Chudnovskiy A., Castro T.B.R., Nakandakari-Higa S., Cui A., Lin C.H., Sade-Feldman M., Phillips B.K., Pae J., Mesin L., Victora G.D. Sci Immunol 9: eadq8843-eadq8843 (2024)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Mouse CD40 ligand (Cd40lg), partial (Active)
Recombinant Mouse CD40 ligand (Cd40lg), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cancer
Uniprot ID: P27548
Gene Names: Cd40lg
Alternative Name(s): CD40 ligand;CD40-L; T-cell antigen Gp39TNF-related activation protein (TRAP); Tumor necrosis factor ligand superfamily member 5; CD154; Cd40lg; Cd40l, Tnfsf5
Abbreviation: Recombinant Mouse Cd40lg protein, partial (Active)
Organism: Mus musculus (Mouse)
Source: Mammalian cell
Expression Region: 112-260aa
Protein Length: Partial
Tag Info: N-terminal mFc1-tagged
Target Protein Sequence: MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
MW: 42.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40(CSB-MP004936MO1) at 2 μg/mL can bind Mouse Cd40lg.The EC50 is 5.121-6.085 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching. CD40 ligand, soluble form Acts as a ligand for integrins, specifically ITGA5: ITGB1 and ITGAV: ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.
Reference: Proximity-dependent labeling identifies dendritic cells that drive the tumor-specific CD4+ T cell response. Chudnovskiy A., Castro T.B.R., Nakandakari-Higa S., Cui A., Lin C.H., Sade-Feldman M., Phillips B.K., Pae J., Mesin L., Victora G.D. Sci Immunol 9: eadq8843-eadq8843 (2024)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cancer
Uniprot ID: P27548
Gene Names: Cd40lg
Alternative Name(s): CD40 ligand;CD40-L; T-cell antigen Gp39TNF-related activation protein (TRAP); Tumor necrosis factor ligand superfamily member 5; CD154; Cd40lg; Cd40l, Tnfsf5
Abbreviation: Recombinant Mouse Cd40lg protein, partial (Active)
Organism: Mus musculus (Mouse)
Source: Mammalian cell
Expression Region: 112-260aa
Protein Length: Partial
Tag Info: N-terminal mFc1-tagged
Target Protein Sequence: MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
MW: 42.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40(CSB-MP004936MO1) at 2 μg/mL can bind Mouse Cd40lg.The EC50 is 5.121-6.085 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching. CD40 ligand, soluble form Acts as a ligand for integrins, specifically ITGA5: ITGB1 and ITGAV: ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.
Reference: Proximity-dependent labeling identifies dendritic cells that drive the tumor-specific CD4+ T cell response. Chudnovskiy A., Castro T.B.R., Nakandakari-Higa S., Cui A., Lin C.H., Sade-Feldman M., Phillips B.K., Pae J., Mesin L., Victora G.D. Sci Immunol 9: eadq8843-eadq8843 (2024)
Function:











