Recombinant Mouse C-X-C motif chemokine 15 (Cxcl15)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Immunology
Uniprot ID: Q9WVL7
Gene Names: Cxcl15
Alternative Name(s): (Lungkine)(Small-inducible cytokine B15)
Abbreviation: Recombinant Mouse Cxcl15 protein
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 26-167aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
MW: 23.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions.
Reference: "Impaired pulmonary host defense in mice lacking expression of the CXC chemokine lungkine." Chen S.C., Mehrad B., Deng J.C., Vassileva G., Manfra D.J., Cook D.N., Wiekowski M.T., Zlotnik A., Standiford T.J., Lira S.A. J. Immunol. 166: 3362-3368(2001)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Mouse C-X-C motif chemokine 15 (Cxcl15)
Recombinant Mouse C-X-C motif chemokine 15 (Cxcl15)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Immunology
Uniprot ID: Q9WVL7
Gene Names: Cxcl15
Alternative Name(s): (Lungkine)(Small-inducible cytokine B15)
Abbreviation: Recombinant Mouse Cxcl15 protein
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 26-167aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
MW: 23.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions.
Reference: "Impaired pulmonary host defense in mice lacking expression of the CXC chemokine lungkine." Chen S.C., Mehrad B., Deng J.C., Vassileva G., Manfra D.J., Cook D.N., Wiekowski M.T., Zlotnik A., Standiford T.J., Lira S.A. J. Immunol. 166: 3362-3368(2001)
Function:
Original: $619.51
-70%$619.51
$185.85Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Immunology
Uniprot ID: Q9WVL7
Gene Names: Cxcl15
Alternative Name(s): (Lungkine)(Small-inducible cytokine B15)
Abbreviation: Recombinant Mouse Cxcl15 protein
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 26-167aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
MW: 23.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions.
Reference: "Impaired pulmonary host defense in mice lacking expression of the CXC chemokine lungkine." Chen S.C., Mehrad B., Deng J.C., Vassileva G., Manfra D.J., Cook D.N., Wiekowski M.T., Zlotnik A., Standiford T.J., Lira S.A. J. Immunol. 166: 3362-3368(2001)
Function:











