Recombinant Mouse Angiogenin-4 (Ang4)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cardiovascular
Uniprot ID: Q3TMQ6
Gene Names: Ang4
Alternative Name(s): Ang4Angiogenin-4; EC 3.1.27.-
Abbreviation: Recombinant Mouse Ang4 protein
Organism: Mus musculus (Mouse)
Source: Yeast
Expression Region: 25-144aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
MW: 29.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts
Reference: "Angiogenins: a new class of microbicidal proteins involved in innate immunity."Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I.Nat. Immunol. 4: 269-273(2003)
Function: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Mouse Angiogenin-4 (Ang4)
Recombinant Mouse Angiogenin-4 (Ang4)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cardiovascular
Uniprot ID: Q3TMQ6
Gene Names: Ang4
Alternative Name(s): Ang4Angiogenin-4; EC 3.1.27.-
Abbreviation: Recombinant Mouse Ang4 protein
Organism: Mus musculus (Mouse)
Source: Yeast
Expression Region: 25-144aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
MW: 29.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts
Reference: "Angiogenins: a new class of microbicidal proteins involved in innate immunity."Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I.Nat. Immunol. 4: 269-273(2003)
Function: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
Original: $11,506,098.07
-70%$11,506,098.07
$3,451,829.42Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cardiovascular
Uniprot ID: Q3TMQ6
Gene Names: Ang4
Alternative Name(s): Ang4Angiogenin-4; EC 3.1.27.-
Abbreviation: Recombinant Mouse Ang4 protein
Organism: Mus musculus (Mouse)
Source: Yeast
Expression Region: 25-144aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
MW: 29.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts
Reference: "Angiogenins: a new class of microbicidal proteins involved in innate immunity."Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I.Nat. Immunol. 4: 269-273(2003)
Function: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).











