Recombinant Macrovipera lebetina obtusa Disintegrin obtustatin
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P83469
Gene Names: N/A
Alternative Name(s):
Abbreviation: Recombinant Macrovipera lebetina obtusa Disintegrin obtustatin protein
Organism: Macrovipera lebetina obtusa (Levant blunt-nosed viper) (Vipera lebetina obtusa)
Source: E.coli
Expression Region: 1-41aa
Protein Length: Full Length
Tag Info: N-terminal GST-tagged
Target Protein Sequence: CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG
MW: 31.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Is a potent and selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin. It blocks the adhesion of alpha-1/beta-1-expressing K562 cells to immobilized collagens IV and I with IC(50) of 2 and 0.5 nM, respectively. Potently inhibits angiogenesis in chicken and in mouse model and reduces tumor development by half. Is 25-fold less potent than viperistatin.
Reference: "Obtustatin: a potent selective inhibitor of alpha1beta1 integrin in vitro and angiogenesis in vivo." Marcinkiewicz C., Weinreb P.H., Calvete J.J., Kisiel D.G., Mousa S.A., Tuszynski G.P., Lobb R.R. Cancer Res. 63: 2020-2023(2003)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Macrovipera lebetina obtusa Disintegrin obtustatin
Recombinant Macrovipera lebetina obtusa Disintegrin obtustatin
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P83469
Gene Names: N/A
Alternative Name(s):
Abbreviation: Recombinant Macrovipera lebetina obtusa Disintegrin obtustatin protein
Organism: Macrovipera lebetina obtusa (Levant blunt-nosed viper) (Vipera lebetina obtusa)
Source: E.coli
Expression Region: 1-41aa
Protein Length: Full Length
Tag Info: N-terminal GST-tagged
Target Protein Sequence: CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG
MW: 31.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Is a potent and selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin. It blocks the adhesion of alpha-1/beta-1-expressing K562 cells to immobilized collagens IV and I with IC(50) of 2 and 0.5 nM, respectively. Potently inhibits angiogenesis in chicken and in mouse model and reduces tumor development by half. Is 25-fold less potent than viperistatin.
Reference: "Obtustatin: a potent selective inhibitor of alpha1beta1 integrin in vitro and angiogenesis in vivo." Marcinkiewicz C., Weinreb P.H., Calvete J.J., Kisiel D.G., Mousa S.A., Tuszynski G.P., Lobb R.R. Cancer Res. 63: 2020-2023(2003)
Function:
Original: $619.51
-70%$619.51
$185.85Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P83469
Gene Names: N/A
Alternative Name(s):
Abbreviation: Recombinant Macrovipera lebetina obtusa Disintegrin obtustatin protein
Organism: Macrovipera lebetina obtusa (Levant blunt-nosed viper) (Vipera lebetina obtusa)
Source: E.coli
Expression Region: 1-41aa
Protein Length: Full Length
Tag Info: N-terminal GST-tagged
Target Protein Sequence: CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG
MW: 31.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Is a potent and selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin. It blocks the adhesion of alpha-1/beta-1-expressing K562 cells to immobilized collagens IV and I with IC(50) of 2 and 0.5 nM, respectively. Potently inhibits angiogenesis in chicken and in mouse model and reduces tumor development by half. Is 25-fold less potent than viperistatin.
Reference: "Obtustatin: a potent selective inhibitor of alpha1beta1 integrin in vitro and angiogenesis in vivo." Marcinkiewicz C., Weinreb P.H., Calvete J.J., Kisiel D.G., Mousa S.A., Tuszynski G.P., Lobb R.R. Cancer Res. 63: 2020-2023(2003)
Function:











