Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: A0A7N9CAT7
Gene Names: TSLP
Alternative Name(s): Thymic stromal lymphopoietin; TSLP
Abbreviation: Recombinant Cynomolgus monkey TSLP protein (R127A,R130S) (Active)
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source: Mammalian cell
Expression Region: 29-159aa(R127A,R130S)
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
MW: 16.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: ①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP(R127A,R130S) at 2 μg/ml can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 45.77-53.37 ng/mL. ②Loaded Cynomolgus TSLP(R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody(CSB-RA025141MA1HU), with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime).
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: /
Reference: /
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active)
Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: A0A7N9CAT7
Gene Names: TSLP
Alternative Name(s): Thymic stromal lymphopoietin; TSLP
Abbreviation: Recombinant Cynomolgus monkey TSLP protein (R127A,R130S) (Active)
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source: Mammalian cell
Expression Region: 29-159aa(R127A,R130S)
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
MW: 16.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: ①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP(R127A,R130S) at 2 μg/ml can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 45.77-53.37 ng/mL. ②Loaded Cynomolgus TSLP(R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody(CSB-RA025141MA1HU), with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime).
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: /
Reference: /
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: A0A7N9CAT7
Gene Names: TSLP
Alternative Name(s): Thymic stromal lymphopoietin; TSLP
Abbreviation: Recombinant Cynomolgus monkey TSLP protein (R127A,R130S) (Active)
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source: Mammalian cell
Expression Region: 29-159aa(R127A,R130S)
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
MW: 16.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: ①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP(R127A,R130S) at 2 μg/ml can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 45.77-53.37 ng/mL. ②Loaded Cynomolgus TSLP(R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody(CSB-RA025141MA1HU), with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime).
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: /
Reference: /
Function:











