Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Obesity
Uniprot ID: A0A2K5VD75
Gene Names: GIPR
Alternative Name(s):
Abbreviation: Recombinant Cynomolgus monkey GIPR protein, partial (Active)
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source: Yeast
Expression Region: 26-138aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
MW: 14.5 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 12.66-13.86 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial (Active)
Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Obesity
Uniprot ID: A0A2K5VD75
Gene Names: GIPR
Alternative Name(s):
Abbreviation: Recombinant Cynomolgus monkey GIPR protein, partial (Active)
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source: Yeast
Expression Region: 26-138aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
MW: 14.5 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 12.66-13.86 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:
Original: $11,506,098.07
-70%$11,506,098.07
$3,451,829.42Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Obesity
Uniprot ID: A0A2K5VD75
Gene Names: GIPR
Alternative Name(s):
Abbreviation: Recombinant Cynomolgus monkey GIPR protein, partial (Active)
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source: Yeast
Expression Region: 26-138aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
MW: 14.5 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 12.66-13.86 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:











