Recombinant Locusta migratoria OBP10 protein (OBP10) (I18L,V57I,N131Q)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cardiovascular
Uniprot ID: H2CSN4
Gene Names: OBP10
Alternative Name(s):
Abbreviation: Recombinant Locusta migratoria OBP10 protein (I18L,V57I,N131Q)
Organism: Locusta migratoria (Migratory locust)
Source: E.coli
Expression Region: 1-133aa(I18L,V57I,N131Q)
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged
Target Protein Sequence: AISESMSRAEEAASKIDLPELFEECNETFTIPKVTLNYFFSHGRLQNENDYGSKCFIHCLTDRSGEIDSDGNFDVDLIKVMTRRFPNETNIEGLNEMVETCVADRGETDFCERAYGLVSCLVKEKLARLGQSH
MW: 21.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion.
Reference: "Molecular cloning of the mouse equivalent of CD9 antigen." Rubinstein E., Billard M., Plaisance S., Prenant M., Boucheix C. Thromb. Res. 71: 377-383(1993)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Locusta migratoria OBP10 protein (OBP10) (I18L,V57I,N131Q)
Recombinant Locusta migratoria OBP10 protein (OBP10) (I18L,V57I,N131Q)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cardiovascular
Uniprot ID: H2CSN4
Gene Names: OBP10
Alternative Name(s):
Abbreviation: Recombinant Locusta migratoria OBP10 protein (I18L,V57I,N131Q)
Organism: Locusta migratoria (Migratory locust)
Source: E.coli
Expression Region: 1-133aa(I18L,V57I,N131Q)
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged
Target Protein Sequence: AISESMSRAEEAASKIDLPELFEECNETFTIPKVTLNYFFSHGRLQNENDYGSKCFIHCLTDRSGEIDSDGNFDVDLIKVMTRRFPNETNIEGLNEMVETCVADRGETDFCERAYGLVSCLVKEKLARLGQSH
MW: 21.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion.
Reference: "Molecular cloning of the mouse equivalent of CD9 antigen." Rubinstein E., Billard M., Plaisance S., Prenant M., Boucheix C. Thromb. Res. 71: 377-383(1993)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cardiovascular
Uniprot ID: H2CSN4
Gene Names: OBP10
Alternative Name(s):
Abbreviation: Recombinant Locusta migratoria OBP10 protein (I18L,V57I,N131Q)
Organism: Locusta migratoria (Migratory locust)
Source: E.coli
Expression Region: 1-133aa(I18L,V57I,N131Q)
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged
Target Protein Sequence: AISESMSRAEEAASKIDLPELFEECNETFTIPKVTLNYFFSHGRLQNENDYGSKCFIHCLTDRSGEIDSDGNFDVDLIKVMTRRFPNETNIEGLNEMVETCVADRGETDFCERAYGLVSCLVKEKLARLGQSH
MW: 21.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion.
Reference: "Molecular cloning of the mouse equivalent of CD9 antigen." Rubinstein E., Billard M., Plaisance S., Prenant M., Boucheix C. Thromb. Res. 71: 377-383(1993)
Function:











