HomeStore

Recombinant Junin mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product image 1

Recombinant Junin mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial

Recombinant Junin mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P26313

Gene Names: GPC

Alternative Name(s): (Pre-GP-C)

Abbreviation: Recombinant Junin mammarenavirus GPC protein, partial

Organism: Junin mammarenavirus (JUNV) (Junn mammarenavirus)

Source: E.coli

Expression Region: 59-251aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: EEAFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRSLK

MW: 29.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: [Glycoprotein G2]: Class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.; Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.; [Glycoprotein G1]: Interacts with the host receptor. Mediates virus attachment to host TFRC. This attachment induces virion internalization predominantly through clathrin-mediated endocytosis.

Reference: "Involvement of cellular proteins in Junin arenavirus entry." Martinez M.G., Forlenza M.B., Candurra N.A. Biotechnol. J. 4: 866-870(2009)

Function:

$269.40

Original: $898.01

-70%
Recombinant Junin mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial

$898.01

$269.40

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P26313

Gene Names: GPC

Alternative Name(s): (Pre-GP-C)

Abbreviation: Recombinant Junin mammarenavirus GPC protein, partial

Organism: Junin mammarenavirus (JUNV) (Junn mammarenavirus)

Source: E.coli

Expression Region: 59-251aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: EEAFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRSLK

MW: 29.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: [Glycoprotein G2]: Class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.; Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.; [Glycoprotein G1]: Interacts with the host receptor. Mediates virus attachment to host TFRC. This attachment induces virion internalization predominantly through clathrin-mediated endocytosis.

Reference: "Involvement of cellular proteins in Junin arenavirus entry." Martinez M.G., Forlenza M.B., Candurra N.A. Biotechnol. J. 4: 866-870(2009)

Function:

You may also like

-70%NEW
Thumbnail 1

Phi29 DNA Polymerase

$96.90

$29.07

-70%NEW
Thumbnail 1Thumbnail 2

Disposable Sampling Swab-Nasal Swab

$12,173.46

$3,652.04

-70%NEW
Thumbnail 1

Horse Cystic fibrosis transmembrane conductance regulator (CFTR) ELISA Kit

$100,503.55

$30,151.06

-70%NEW
Thumbnail 1

Sheep anti-human C-Reactive Protein (CRP) PolyClonal antibody (Copy)

$52,461.84

$15,738.55

NEW

TransNGS® 384 UDI Indexed Adapter Kit for Illumina®

$48,693.86

-70%NEW

TransNGS® UDI Indexed Adapter Kit for Illumina®

$19,492.04

$5,847.61

NEW
Thumbnail 1

Mouse Tbkbp1/ TANK-binding kinase 1-binding protein 1 ELISA Kit

$97,822.49

NEW
Thumbnail 1

Pig FGA/ Fibrinogen alpha chain ELISA Kit

$113,401.62

-70%NEW
Thumbnail 1

Chicken GAL/ Galanin ELISA Kit

$113,401.62

$34,020.49

-70%NEW
Thumbnail 1

Human MYDGF/ Myeloid-derived growth factor ELISA Kit

$92,750.21

$27,825.06

NEW
Thumbnail 1

Rat Ugt1a8/ UDP-glucuronosyltransferase 1-8 ELISA Kit

$100,358.62

-70%NEW
Thumbnail 1

Human LTA4H/ Leukotriene A-4 hydrolase ELISA Kit

$92,750.21

$27,825.06