Recombinant Ixodes scapularis Tick receptor for ospA (TROSPA)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q5SDL7
Gene Names: TROSPA
Alternative Name(s):
Abbreviation: Recombinant Ixodes scapularis TROSPA protein
Organism: Ixodes scapularis (Black-legged tick) (Deer tick)
Source: E.coli
Expression Region: 1-161aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: MVAMEAMAAMEVMVAAMAATADTVASSAASATATEATVAMDTASLSLPLQLSPRSLPQSSLSATAATVATDTVVSSADTEVSDTEDSAATVSATASLSMLPQSSPRSLPQSSLSATAATVDSVTDMADTAMDTKQFISKGNEHFFAASYLCAWADQSAAGS
MW: 20.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Serves as a receptor for ospA protein of B.burgdorferi, the Lyme disease agent. Required for spirochetal colonization. Essential for pathogen adherence to the vector.
Reference: "TROSPA, an Ixodes scapularis receptor for Borrelia burgdorferi." Pal U., Li X., Wang T., Montgomery R.R., Ramamoorthi N., Desilva A.M., Bao F., Yang X., Pypaert M., Pradhan D., Kantor F.S., Telford S., Anderson J.F., Fikrig E. Cell 119: 457-468(2004)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Ixodes scapularis Tick receptor for ospA (TROSPA)
Recombinant Ixodes scapularis Tick receptor for ospA (TROSPA)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q5SDL7
Gene Names: TROSPA
Alternative Name(s):
Abbreviation: Recombinant Ixodes scapularis TROSPA protein
Organism: Ixodes scapularis (Black-legged tick) (Deer tick)
Source: E.coli
Expression Region: 1-161aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: MVAMEAMAAMEVMVAAMAATADTVASSAASATATEATVAMDTASLSLPLQLSPRSLPQSSLSATAATVATDTVVSSADTEVSDTEDSAATVSATASLSMLPQSSPRSLPQSSLSATAATVDSVTDMADTAMDTKQFISKGNEHFFAASYLCAWADQSAAGS
MW: 20.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Serves as a receptor for ospA protein of B.burgdorferi, the Lyme disease agent. Required for spirochetal colonization. Essential for pathogen adherence to the vector.
Reference: "TROSPA, an Ixodes scapularis receptor for Borrelia burgdorferi." Pal U., Li X., Wang T., Montgomery R.R., Ramamoorthi N., Desilva A.M., Bao F., Yang X., Pypaert M., Pradhan D., Kantor F.S., Telford S., Anderson J.F., Fikrig E. Cell 119: 457-468(2004)
Function:
Original: $619.51
-70%$619.51
$185.85Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q5SDL7
Gene Names: TROSPA
Alternative Name(s):
Abbreviation: Recombinant Ixodes scapularis TROSPA protein
Organism: Ixodes scapularis (Black-legged tick) (Deer tick)
Source: E.coli
Expression Region: 1-161aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: MVAMEAMAAMEVMVAAMAATADTVASSAASATATEATVAMDTASLSLPLQLSPRSLPQSSLSATAATVATDTVVSSADTEVSDTEDSAATVSATASLSMLPQSSPRSLPQSSLSATAATVDSVTDMADTAMDTKQFISKGNEHFFAASYLCAWADQSAAGS
MW: 20.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Serves as a receptor for ospA protein of B.burgdorferi, the Lyme disease agent. Required for spirochetal colonization. Essential for pathogen adherence to the vector.
Reference: "TROSPA, an Ixodes scapularis receptor for Borrelia burgdorferi." Pal U., Li X., Wang T., Montgomery R.R., Ramamoorthi N., Desilva A.M., Bao F., Yang X., Pypaert M., Pradhan D., Kantor F.S., Telford S., Anderson J.F., Fikrig E. Cell 119: 457-468(2004)
Function:











