HomeStore

Recombinant Human Vacuolar protein sorting-associated protein 13D (VPS13D), partial

Product image 1

Recombinant Human Vacuolar protein sorting-associated protein 13D (VPS13D), partial

Recombinant Human Vacuolar protein sorting-associated protein 13D (VPS13D), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: Q5THJ4

Gene Names: VPS13D

Alternative Name(s): (Vacuolar protein sorting-associated protein 13D)

Abbreviation: Recombinant Human VPS13D protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 3276-3558aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: LKIFISAPYWLINKTGLPLIFRQDNAKTDAAGQFEEHELARSLSPLLFCYADKEQPNLCTMRIGRGIHPEGMPGWCQGFSLDGGSGVRALKVIQQGNRPGLIYNIGIDVKKGRGRYIDTCMVIFAPRYLLDNKSSHKLAFAQREFARGQGTANPEGYISTLPGSSVVFHWPRNDYDQLLCVRLMDVPNCIWSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPMTSLDYAWDEPTL

MW: 38.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Mediates the transfer of lipids between membranes at organelle contact sites. Functions in promoting mitochondrial clearance by mitochondrial autophagy (mitophagy), also possibly by positively regulating mitochondrial fission. Mitophagy plays an important role in regulating cell health and mitochondrial size and homeostasis.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14: 2121-2127(2004)

Function:

$85,431.64
Recombinant Human Vacuolar protein sorting-associated protein 13D (VPS13D), partial
$85,431.64

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: Q5THJ4

Gene Names: VPS13D

Alternative Name(s): (Vacuolar protein sorting-associated protein 13D)

Abbreviation: Recombinant Human VPS13D protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 3276-3558aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: LKIFISAPYWLINKTGLPLIFRQDNAKTDAAGQFEEHELARSLSPLLFCYADKEQPNLCTMRIGRGIHPEGMPGWCQGFSLDGGSGVRALKVIQQGNRPGLIYNIGIDVKKGRGRYIDTCMVIFAPRYLLDNKSSHKLAFAQREFARGQGTANPEGYISTLPGSSVVFHWPRNDYDQLLCVRLMDVPNCIWSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPMTSLDYAWDEPTL

MW: 38.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Mediates the transfer of lipids between membranes at organelle contact sites. Functions in promoting mitochondrial clearance by mitochondrial autophagy (mitophagy), also possibly by positively regulating mitochondrial fission. Mitophagy plays an important role in regulating cell health and mitochondrial size and homeostasis.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14: 2121-2127(2004)

Function:

You may also like

-70%NEW
Thumbnail 1

Phi29 DNA Polymerase

$96.90

$29.07

-70%NEW
Thumbnail 1Thumbnail 2

Disposable Sampling Swab-Nasal Swab

$12,173.46

$3,652.04

-70%NEW
Thumbnail 1

Horse Cystic fibrosis transmembrane conductance regulator (CFTR) ELISA Kit

$100,503.55

$30,151.06

-70%NEW
Thumbnail 1

Sheep anti-human C-Reactive Protein (CRP) PolyClonal antibody (Copy)

$52,461.84

$15,738.55

NEW

TransNGS® 384 UDI Indexed Adapter Kit for Illumina®

$48,693.86

-70%NEW

TransNGS® UDI Indexed Adapter Kit for Illumina®

$19,492.04

$5,847.61

NEW
Thumbnail 1

Mouse Tbkbp1/ TANK-binding kinase 1-binding protein 1 ELISA Kit

$97,822.49

NEW
Thumbnail 1

Pig FGA/ Fibrinogen alpha chain ELISA Kit

$113,401.62

-70%NEW
Thumbnail 1

Chicken GAL/ Galanin ELISA Kit

$113,401.62

$34,020.49

-70%NEW
Thumbnail 1

Human MYDGF/ Myeloid-derived growth factor ELISA Kit

$92,750.21

$27,825.06

NEW
Thumbnail 1

Rat Ugt1a8/ UDP-glucuronosyltransferase 1-8 ELISA Kit

$100,358.62

-70%NEW
Thumbnail 1

Human LTA4H/ Leukotriene A-4 hydrolase ELISA Kit

$92,750.21

$27,825.06