Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cancer
Uniprot ID: O14763
Gene Names: TNFRSF10B
Alternative Name(s): Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2 (TRAIL receptor 2; TRAIL-R2); CD262; TNFRSF10B; DR5, KILLER, TRAILR2, TRICK2, ZTNFR9; UNQ160/PRO186
Abbreviation: Recombinant Human TNFRSF10B protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 56-182aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
MW: 15.7 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF10B at 2 μg/mL can bind Anti-TNFRSF10B recombinant antibody (CSB-RA023965MA2HU). The EC50 is 1.880-2.195 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Reference: The full-ORF clone resource of the German cDNA consortium. Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Schupp I. BMC Genomics 8: 399-399 (2007)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)
Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cancer
Uniprot ID: O14763
Gene Names: TNFRSF10B
Alternative Name(s): Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2 (TRAIL receptor 2; TRAIL-R2); CD262; TNFRSF10B; DR5, KILLER, TRAILR2, TRICK2, ZTNFR9; UNQ160/PRO186
Abbreviation: Recombinant Human TNFRSF10B protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 56-182aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
MW: 15.7 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF10B at 2 μg/mL can bind Anti-TNFRSF10B recombinant antibody (CSB-RA023965MA2HU). The EC50 is 1.880-2.195 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Reference: The full-ORF clone resource of the German cDNA consortium. Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Schupp I. BMC Genomics 8: 399-399 (2007)
Function:
Original: $922.43
-70%$922.43
$276.73Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cancer
Uniprot ID: O14763
Gene Names: TNFRSF10B
Alternative Name(s): Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2 (TRAIL receptor 2; TRAIL-R2); CD262; TNFRSF10B; DR5, KILLER, TRAILR2, TRICK2, ZTNFR9; UNQ160/PRO186
Abbreviation: Recombinant Human TNFRSF10B protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 56-182aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
MW: 15.7 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF10B at 2 μg/mL can bind Anti-TNFRSF10B recombinant antibody (CSB-RA023965MA2HU). The EC50 is 1.880-2.195 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Reference: The full-ORF clone resource of the German cDNA consortium. Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Schupp I. BMC Genomics 8: 399-399 (2007)
Function:











