HomeStore

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Product image 1

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Epigenetics and Nuclear Signaling

Uniprot ID: Q92804

Gene Names: TAF15

Alternative Name(s): 68 TATA-binding protein-associated factor;TAF(II;TAFII68;RNA-binding protein 56

Abbreviation: Recombinant Human TAF15 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 7-99 aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-Trx-tagged and C-terminal 6xHis-tagged

Target Protein Sequence: YGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQG

MW: 29.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Can enter the preinitiation complex together with the RNA polymerase II (Pol II).

Reference:

Function:

$21,281.83

Original: $70,939.42

-70%
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

$70,939.42

$21,281.83

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Epigenetics and Nuclear Signaling

Uniprot ID: Q92804

Gene Names: TAF15

Alternative Name(s): 68 TATA-binding protein-associated factor;TAF(II;TAFII68;RNA-binding protein 56

Abbreviation: Recombinant Human TAF15 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 7-99 aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-Trx-tagged and C-terminal 6xHis-tagged

Target Protein Sequence: YGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQG

MW: 29.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Can enter the preinitiation complex together with the RNA polymerase II (Pol II).

Reference:

Function: