Recombinant Human Sodium- and chloride-dependent neutral and basic amino acid transporter B (0+) (SLC6A14), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Signal Transduction
Uniprot ID: Q9UN76
Gene Names: SLC6A14
Alternative Name(s): Amino acid transporter ATB0+;Solute carrier family 6 member 14
Abbreviation: Recombinant Human SLC6A14 protein, partial
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 131-234aa
Protein Length: Partial
Tag Info: C-terminal Myc-tagged
Target Protein Sequence: YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV
MW: 13.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Amino acid transporter that plays an important role in the absorption of amino acids in the intestinal tract. Mediates the uptake of a broad range of neutral and cationic amino acids (with the exception of proline) in a Na(+)/Cl(-)-dependent manner. Transports non-alpha-amino acids such as beta-alanine with low affinity, and has a higher affinity for dipolar and cationic amino acids such as leucine and lysine. Can also transport carnitine and propionylcarnitine coupled to the transmembrane gradients of Na(+) and Cl(-).
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Recombinant Human Sodium- and chloride-dependent neutral and basic amino acid transporter B (0+) (SLC6A14), partial
Recombinant Human Sodium- and chloride-dependent neutral and basic amino acid transporter B (0+) (SLC6A14), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Signal Transduction
Uniprot ID: Q9UN76
Gene Names: SLC6A14
Alternative Name(s): Amino acid transporter ATB0+;Solute carrier family 6 member 14
Abbreviation: Recombinant Human SLC6A14 protein, partial
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 131-234aa
Protein Length: Partial
Tag Info: C-terminal Myc-tagged
Target Protein Sequence: YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV
MW: 13.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Amino acid transporter that plays an important role in the absorption of amino acids in the intestinal tract. Mediates the uptake of a broad range of neutral and cationic amino acids (with the exception of proline) in a Na(+)/Cl(-)-dependent manner. Transports non-alpha-amino acids such as beta-alanine with low affinity, and has a higher affinity for dipolar and cationic amino acids such as leucine and lysine. Can also transport carnitine and propionylcarnitine coupled to the transmembrane gradients of Na(+) and Cl(-).
Reference:
Function:
Original: $2,099.20
-70%$2,099.20
$629.76Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Signal Transduction
Uniprot ID: Q9UN76
Gene Names: SLC6A14
Alternative Name(s): Amino acid transporter ATB0+;Solute carrier family 6 member 14
Abbreviation: Recombinant Human SLC6A14 protein, partial
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 131-234aa
Protein Length: Partial
Tag Info: C-terminal Myc-tagged
Target Protein Sequence: YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV
MW: 13.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Amino acid transporter that plays an important role in the absorption of amino acids in the intestinal tract. Mediates the uptake of a broad range of neutral and cationic amino acids (with the exception of proline) in a Na(+)/Cl(-)-dependent manner. Transports non-alpha-amino acids such as beta-alanine with low affinity, and has a higher affinity for dipolar and cationic amino acids such as leucine and lysine. Can also transport carnitine and propionylcarnitine coupled to the transmembrane gradients of Na(+) and Cl(-).
Reference:
Function:
