HomeStore

Recombinant Human Protein FAM3B (FAM3B)

Product image 1

Recombinant Human Protein FAM3B (FAM3B)

Recombinant Human Protein FAM3B (FAM3B)

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P58499

Gene Names: FAM3B

Alternative Name(s): (Cytokine-like protein 2-21)(Pancreatic-derived factor)(PANDER)

Abbreviation: Recombinant Human FAM3B protein

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 30-235aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

MW: 30.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.

Reference: "New genetic associations detected in a host response study to hepatitis B vaccine." Davila S., Froeling F.E., Tan A., Bonnard C., Boland G.J., Snippe H., Hibberd M.L., Seielstad M. Genes Immun 11: 232-238(2010)

Function:

$25,629.49

Original: $85,431.64

-70%
Recombinant Human Protein FAM3B (FAM3B)

$85,431.64

$25,629.49

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P58499

Gene Names: FAM3B

Alternative Name(s): (Cytokine-like protein 2-21)(Pancreatic-derived factor)(PANDER)

Abbreviation: Recombinant Human FAM3B protein

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 30-235aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

MW: 30.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.

Reference: "New genetic associations detected in a host response study to hepatitis B vaccine." Davila S., Froeling F.E., Tan A., Bonnard C., Boland G.J., Snippe H., Hibberd M.L., Seielstad M. Genes Immun 11: 232-238(2010)

Function:

Recombinant Human Protein FAM3B (FAM3B) | GeneBio