HomeStore

Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial, Biotinylated (Active)

Product image 1

Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial, Biotinylated (Active)

Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial, Biotinylated (Active)

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: Q68D85

Gene Names: NCR3LG1

Alternative Name(s): Natural cytotoxicity triggering receptor 3 ligand 1; B7 homolog 6 (B7-H6); NCR3LG1; B7H6

Abbreviation: Recombinant Human NCR3LG1 protein, partial, Biotinylated (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 25-262aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-Avi-tagged

Target Protein Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS

MW: 30.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Anti-NCR3LG1 recombinant antibody(CSB-RA737873MA1HU) at 2 μg/mL can bind Human NCR3LG1. The EC50 is 0.4364-0.5147 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized human NCR3(CSB-MP015551HU1) at 5 μg/mL can bind Human NCR3LG1. The EC50 is 111.3-303.1 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Triggers NCR3-dependent natural killer cell activation.

Reference: The full-ORF clone resource of the German cDNA consortium. Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Schupp I. BMC Genomics 8: 399-399 (2007)

Function:

$496.94

Original: $1,656.46

-70%
Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial, Biotinylated (Active)

$1,656.46

$496.94

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: Q68D85

Gene Names: NCR3LG1

Alternative Name(s): Natural cytotoxicity triggering receptor 3 ligand 1; B7 homolog 6 (B7-H6); NCR3LG1; B7H6

Abbreviation: Recombinant Human NCR3LG1 protein, partial, Biotinylated (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 25-262aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-Avi-tagged

Target Protein Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS

MW: 30.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Anti-NCR3LG1 recombinant antibody(CSB-RA737873MA1HU) at 2 μg/mL can bind Human NCR3LG1. The EC50 is 0.4364-0.5147 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized human NCR3(CSB-MP015551HU1) at 5 μg/mL can bind Human NCR3LG1. The EC50 is 111.3-303.1 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Triggers NCR3-dependent natural killer cell activation.

Reference: The full-ORF clone resource of the German cDNA consortium. Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Schupp I. BMC Genomics 8: 399-399 (2007)

Function: