Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q08722
Gene Names: CD47
Alternative Name(s): Antigenic surface determinant protein OA3（Integrin-associated protein）（IAP）（Protein MER6）（CD47）
Abbreviation: Recombinant Human CD47 protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 19-139aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
MW: 15.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Human CD47 (CSB-MP004940HUd7) at 2 μg/mL can bind Human SIRPA protein. The EC50 is 98.73-112.7 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 1.343-1.561 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.
Reference: "An ovarian tumor marker with homology to vaccinia virus contains an IgV-like region and multiple transmembrane domains." Campbell I.G., Freemont P.S., Foulkes W., Trowsdale J. Cancer Res. 52: 5416-5420(1992)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)
Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q08722
Gene Names: CD47
Alternative Name(s): Antigenic surface determinant protein OA3（Integrin-associated protein）（IAP）（Protein MER6）（CD47）
Abbreviation: Recombinant Human CD47 protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 19-139aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
MW: 15.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Human CD47 (CSB-MP004940HUd7) at 2 μg/mL can bind Human SIRPA protein. The EC50 is 98.73-112.7 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 1.343-1.561 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.
Reference: "An ovarian tumor marker with homology to vaccinia virus contains an IgV-like region and multiple transmembrane domains." Campbell I.G., Freemont P.S., Foulkes W., Trowsdale J. Cancer Res. 52: 5416-5420(1992)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q08722
Gene Names: CD47
Alternative Name(s): Antigenic surface determinant protein OA3（Integrin-associated protein）（IAP）（Protein MER6）（CD47）
Abbreviation: Recombinant Human CD47 protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 19-139aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
MW: 15.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Human CD47 (CSB-MP004940HUd7) at 2 μg/mL can bind Human SIRPA protein. The EC50 is 98.73-112.7 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 1.343-1.561 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.
Reference: "An ovarian tumor marker with homology to vaccinia virus contains an IgV-like region and multiple transmembrane domains." Campbell I.G., Freemont P.S., Foulkes W., Trowsdale J. Cancer Res. 52: 5416-5420(1992)
Function:
