Recombinant Human Interleukin-3 (IL3) (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: P08700
Gene Names: IL3
Alternative Name(s): IL-3;Hematopoietic growth factor;Mast cell growth factor;MCGF;Multipotential colony-stimulating factor;P-cell-stimulating factor
Abbreviation: Recombinant Human IL3 protein (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 20-152aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
MW: 16.5 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3149 to 1.023 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells.
Reference: The DNA sequence and comparative analysis of human chromosome 5. Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Rubin E.M. Nature 431: 268-274 (2004)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Recombinant Human Interleukin-3 (IL3) (Active)
Recombinant Human Interleukin-3 (IL3) (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: P08700
Gene Names: IL3
Alternative Name(s): IL-3;Hematopoietic growth factor;Mast cell growth factor;MCGF;Multipotential colony-stimulating factor;P-cell-stimulating factor
Abbreviation: Recombinant Human IL3 protein (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 20-152aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
MW: 16.5 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3149 to 1.023 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells.
Reference: The DNA sequence and comparative analysis of human chromosome 5. Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Rubin E.M. Nature 431: 268-274 (2004)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: P08700
Gene Names: IL3
Alternative Name(s): IL-3;Hematopoietic growth factor;Mast cell growth factor;MCGF;Multipotential colony-stimulating factor;P-cell-stimulating factor
Abbreviation: Recombinant Human IL3 protein (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 20-152aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
MW: 16.5 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3149 to 1.023 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells.
Reference: The DNA sequence and comparative analysis of human chromosome 5. Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Rubin E.M. Nature 431: 268-274 (2004)
Function:
