Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cell Biology
Uniprot ID: Q9H665
Gene Names: IGFLR1
Alternative Name(s): (Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4)
Abbreviation: Recombinant Human IGFLR1 protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 23-163aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
MW: 17.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HU), the EC50 is 32.33-47.52 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)
Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cell Biology
Uniprot ID: Q9H665
Gene Names: IGFLR1
Alternative Name(s): (Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4)
Abbreviation: Recombinant Human IGFLR1 protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 23-163aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
MW: 17.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HU), the EC50 is 32.33-47.52 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Reference:
Function:
Original: $423.75
-70%$423.75
$127.12Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Cell Biology
Uniprot ID: Q9H665
Gene Names: IGFLR1
Alternative Name(s): (Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4)
Abbreviation: Recombinant Human IGFLR1 protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 23-163aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
MW: 17.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HU), the EC50 is 32.33-47.52 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Reference:
Function:











