Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Signal Transduction
Uniprot ID: O95727
Gene Names: CRTAM
Alternative Name(s): Class-I MHC-restricted T-cell-associated molecule;CD355
Abbreviation: Recombinant Human CRTAM protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 18-287aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
MW: 31.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CRTAM at 2 μg/mL can bind Human CADM1(CSB-MP004425HUd9) , the EC50 is 2.277-2.649 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets. Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-gamma secretion by CD8+ T-cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM1 in vivo.
Reference: "A molecular analysis of NKT cells: identification of a class-I restricted T cell-associated molecule (CRTAM)." Kennedy J., Vicari A.P., Saylor V., Zurawski S.M., Copeland N.G., Gilbert D.J., Jenkins N.A., Zlotnik A. J. Leukoc. Biol. 67: 725-734 (2000)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial (Active)
Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Signal Transduction
Uniprot ID: O95727
Gene Names: CRTAM
Alternative Name(s): Class-I MHC-restricted T-cell-associated molecule;CD355
Abbreviation: Recombinant Human CRTAM protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 18-287aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
MW: 31.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CRTAM at 2 μg/mL can bind Human CADM1(CSB-MP004425HUd9) , the EC50 is 2.277-2.649 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets. Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-gamma secretion by CD8+ T-cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM1 in vivo.
Reference: "A molecular analysis of NKT cells: identification of a class-I restricted T cell-associated molecule (CRTAM)." Kennedy J., Vicari A.P., Saylor V., Zurawski S.M., Copeland N.G., Gilbert D.J., Jenkins N.A., Zlotnik A. J. Leukoc. Biol. 67: 725-734 (2000)
Function:
Original: $249.95
-70%$249.95
$74.98Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Signal Transduction
Uniprot ID: O95727
Gene Names: CRTAM
Alternative Name(s): Class-I MHC-restricted T-cell-associated molecule;CD355
Abbreviation: Recombinant Human CRTAM protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 18-287aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
MW: 31.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CRTAM at 2 μg/mL can bind Human CADM1(CSB-MP004425HUd9) , the EC50 is 2.277-2.649 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets. Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-gamma secretion by CD8+ T-cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM1 in vivo.
Reference: "A molecular analysis of NKT cells: identification of a class-I restricted T cell-associated molecule (CRTAM)." Kennedy J., Vicari A.P., Saylor V., Zurawski S.M., Copeland N.G., Gilbert D.J., Jenkins N.A., Zlotnik A. J. Leukoc. Biol. 67: 725-734 (2000)
Function:











