Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q8WTT0
Gene Names: CLEC4C
Alternative Name(s): Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL;
Abbreviation: Recombinant Human CLEC4C protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 45-213aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-Myc-tagged
Target Protein Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
MW: 24.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU)，the EC50 is 7.658-12.99 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May play a role in antigen capturing by dendritic cells.
Reference: "Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells." Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E. Eur. J. Immunol. 31: 2733-2740 (2001)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)
Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q8WTT0
Gene Names: CLEC4C
Alternative Name(s): Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL;
Abbreviation: Recombinant Human CLEC4C protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 45-213aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-Myc-tagged
Target Protein Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
MW: 24.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU)，the EC50 is 7.658-12.99 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May play a role in antigen capturing by dendritic cells.
Reference: "Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells." Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E. Eur. J. Immunol. 31: 2733-2740 (2001)
Function:
Original: $292.71
-70%$292.71
$87.81Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Immunology
Uniprot ID: Q8WTT0
Gene Names: CLEC4C
Alternative Name(s): Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL;
Abbreviation: Recombinant Human CLEC4C protein, partial (Active)
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 45-213aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-Myc-tagged
Target Protein Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
MW: 24.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU)，the EC50 is 7.658-12.99 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May play a role in antigen capturing by dendritic cells.
Reference: "Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells." Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E. Eur. J. Immunol. 31: 2733-2740 (2001)
Function:
