Recombinant Human Bone morphogenetic protein 15 (BMP15)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Developmental Biology
Uniprot ID: O95972
Gene Names: BMP15
Alternative Name(s): Growth/differentiation factor 9B
Abbreviation: Recombinant Human BMP15 protein
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 268-392aa
Protein Length: Full Length of Mature Protein
Tag Info: Tag-Free
Target Protein Sequence: QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
MW: 14.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
Reference: "Characterization of the post-translational modification of recombinant human BMP-15 mature protein." Saito S., Yano K., Sharma S., McMahon H.E., Shimasaki S. Protein Sci. 17: 362-370(2008)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Human Bone morphogenetic protein 15 (BMP15)
Recombinant Human Bone morphogenetic protein 15 (BMP15)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Developmental Biology
Uniprot ID: O95972
Gene Names: BMP15
Alternative Name(s): Growth/differentiation factor 9B
Abbreviation: Recombinant Human BMP15 protein
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 268-392aa
Protein Length: Full Length of Mature Protein
Tag Info: Tag-Free
Target Protein Sequence: QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
MW: 14.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
Reference: "Characterization of the post-translational modification of recombinant human BMP-15 mature protein." Saito S., Yano K., Sharma S., McMahon H.E., Shimasaki S. Protein Sci. 17: 362-370(2008)
Function:
Original: $497.05
-70%$497.05
$149.12Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Developmental Biology
Uniprot ID: O95972
Gene Names: BMP15
Alternative Name(s): Growth/differentiation factor 9B
Abbreviation: Recombinant Human BMP15 protein
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 268-392aa
Protein Length: Full Length of Mature Protein
Tag Info: Tag-Free
Target Protein Sequence: QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
MW: 14.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
Reference: "Characterization of the post-translational modification of recombinant human BMP-15 mature protein." Saito S., Yano K., Sharma S., McMahon H.E., Shimasaki S. Protein Sci. 17: 362-370(2008)
Function:











