HomeStore

Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), partial

Product image 1

Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), partial

Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: Q9ULZ3

Gene Names: PYCARD

Alternative Name(s): hASC;Caspase recruitment domain-containing protein 5;PYD and CARD domain-containing protein;Target of methylation-induced silencing 1

Abbreviation: Recombinant Human PYCARD protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-93aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGS

MW: 17.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Functions as key mediator in apoptosis and inflammation. Promotes caspase-mediated apoptosis involving predominantly caspase-8 and also caspase-9 in a probable cell type-specific manner. Involved in activation of the mitochondrial apoptotic pathway, promotes caspase-8-dependent proteolytic maturation of BID independently of FADD in certain cell types and also mediates mitochondrial translocation of BAX and activates BAX-dependent apoptosis coupled to activation of caspase-9, -2 and -3. Involved in macrophage pyroptosis, a caspase-1-dependent inflammatory form of cell death and is the major constituent of the ASC pyroptosome which forms upon potassium depletion and rapidly recruits and activates caspase-1. In innate immune response, acts as an integral adapter in the assembly of the inflammasome which activates caspase-1 leading to processing and secretion of pro-inflammatory cytokines. The function as activating adapter in different types of inflammasomes is mediated by the pyrin and CARD domains and their homotypic interactions. Required for recruitment of caspase-1 to inflammasomes containing certain pattern recognition receptors, such as NLRP2, NLRP3, NLRP6, AIM2 and probably IFI16. In the NLRP1 and NLRC4 inflammasomes seems not be required but facilitates the processing of procaspase-1. In cooperation with NOD2 involved in an inflammasome activated by bacterial muramyl dipeptide leading to caspase-1 activation. May be involved in DDX58-triggered pro-inflammatory responses and inflammasome activation. In collaboration with AIM2 which detects cytosolic double-stranded DNA may also be involved in a caspase-1-independent cell death that involves caspase-8. In adaptive immunity may be involved in maturation of dendritic cells to stimulate T-cell immunity and in cytoskeletal rearrangements coupled to chemotaxis and antigen uptake may be involved in post-transcriptional regulation of the guanine nucleotide exchange factor DOCK2; the latter function is proposed to involve the nuclear form. Also involved in transcriptional activation of cytokines and chemokines independent of the inflammasome; this function may involve AP-1, NF-kappa-B, MAPK and caspase-8 signaling pathways. For regulation of NF-kappa-B activating and inhibiting functions have been reported. Modulates NF-kappa-B induction at the level of the IKK complex by inhibiting kinase activity of CHUK and IKBK. Proposed to compete with RIPK2 for association with CASP1 thereby down-regulating CASP1-mediated RIPK2-dependent NF-kappa-B activation and activating interleukin-1 beta processing. Modulates host resistance to DNA virus infection, probably by inducing the cleavage of and inactivating CGAS in presence of cytoplasmic double-stranded DNA. ; [Isoform 2]: May have a regulating effect on the function as inflammasome adapter. ; [Isoform 3]: Seems to inhibit inflammasome-mediated maturation of interleukin-1 beta.

Reference:

Function:

$213.60

Original: $712.00

-70%
Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), partial

$712.00

$213.60

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: Q9ULZ3

Gene Names: PYCARD

Alternative Name(s): hASC;Caspase recruitment domain-containing protein 5;PYD and CARD domain-containing protein;Target of methylation-induced silencing 1

Abbreviation: Recombinant Human PYCARD protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-93aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGS

MW: 17.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Functions as key mediator in apoptosis and inflammation. Promotes caspase-mediated apoptosis involving predominantly caspase-8 and also caspase-9 in a probable cell type-specific manner. Involved in activation of the mitochondrial apoptotic pathway, promotes caspase-8-dependent proteolytic maturation of BID independently of FADD in certain cell types and also mediates mitochondrial translocation of BAX and activates BAX-dependent apoptosis coupled to activation of caspase-9, -2 and -3. Involved in macrophage pyroptosis, a caspase-1-dependent inflammatory form of cell death and is the major constituent of the ASC pyroptosome which forms upon potassium depletion and rapidly recruits and activates caspase-1. In innate immune response, acts as an integral adapter in the assembly of the inflammasome which activates caspase-1 leading to processing and secretion of pro-inflammatory cytokines. The function as activating adapter in different types of inflammasomes is mediated by the pyrin and CARD domains and their homotypic interactions. Required for recruitment of caspase-1 to inflammasomes containing certain pattern recognition receptors, such as NLRP2, NLRP3, NLRP6, AIM2 and probably IFI16. In the NLRP1 and NLRC4 inflammasomes seems not be required but facilitates the processing of procaspase-1. In cooperation with NOD2 involved in an inflammasome activated by bacterial muramyl dipeptide leading to caspase-1 activation. May be involved in DDX58-triggered pro-inflammatory responses and inflammasome activation. In collaboration with AIM2 which detects cytosolic double-stranded DNA may also be involved in a caspase-1-independent cell death that involves caspase-8. In adaptive immunity may be involved in maturation of dendritic cells to stimulate T-cell immunity and in cytoskeletal rearrangements coupled to chemotaxis and antigen uptake may be involved in post-transcriptional regulation of the guanine nucleotide exchange factor DOCK2; the latter function is proposed to involve the nuclear form. Also involved in transcriptional activation of cytokines and chemokines independent of the inflammasome; this function may involve AP-1, NF-kappa-B, MAPK and caspase-8 signaling pathways. For regulation of NF-kappa-B activating and inhibiting functions have been reported. Modulates NF-kappa-B induction at the level of the IKK complex by inhibiting kinase activity of CHUK and IKBK. Proposed to compete with RIPK2 for association with CASP1 thereby down-regulating CASP1-mediated RIPK2-dependent NF-kappa-B activation and activating interleukin-1 beta processing. Modulates host resistance to DNA virus infection, probably by inducing the cleavage of and inactivating CGAS in presence of cytoplasmic double-stranded DNA. ; [Isoform 2]: May have a regulating effect on the function as inflammasome adapter. ; [Isoform 3]: Seems to inhibit inflammasome-mediated maturation of interleukin-1 beta.

Reference:

Function:

You may also like

-70%NEW
Thumbnail 1

Phi29 DNA Polymerase

$96.90

$29.07

-70%NEW
Thumbnail 1Thumbnail 2

Disposable Sampling Swab-Nasal Swab

$12,173.46

$3,652.04

-70%NEW
Thumbnail 1

Horse Cystic fibrosis transmembrane conductance regulator (CFTR) ELISA Kit

$100,503.55

$30,151.06

-70%NEW
Thumbnail 1

Sheep anti-human C-Reactive Protein (CRP) PolyClonal antibody (Copy)

$52,461.84

$15,738.55

NEW

TransNGS® 384 UDI Indexed Adapter Kit for Illumina®

$48,693.86

-70%NEW

TransNGS® UDI Indexed Adapter Kit for Illumina®

$19,492.04

$5,847.61

NEW
Thumbnail 1

Mouse Tbkbp1/ TANK-binding kinase 1-binding protein 1 ELISA Kit

$97,822.49

NEW
Thumbnail 1

Pig FGA/ Fibrinogen alpha chain ELISA Kit

$113,401.62

-70%NEW
Thumbnail 1

Chicken GAL/ Galanin ELISA Kit

$113,401.62

$34,020.49

-70%NEW
Thumbnail 1

Human MYDGF/ Myeloid-derived growth factor ELISA Kit

$92,750.21

$27,825.06

NEW
Thumbnail 1

Rat Ugt1a8/ UDP-glucuronosyltransferase 1-8 ELISA Kit

$100,358.62

-70%NEW
Thumbnail 1

Human LTA4H/ Leukotriene A-4 hydrolase ELISA Kit

$92,750.21

$27,825.06