Recombinant Gymnema sylvestre Gurmarin
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P25810
Gene Names: N/A
Alternative Name(s): (Sweet taste-suppressing peptide)
Abbreviation: Recombinant Gymnema sylvestre Gurmarin protein
Organism: Gymnema sylvestre (Gurmar) (Periploca sylvestris)
Source: E.coli
Expression Region: 1-35aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: QQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG
MW: 19.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Suppresses strongly the sweet taste responses in the rat with high specificity to sucrose, glucose, glycine, and saccharin. This effect is reversible, but complete recovery of the suppressed responses required at least 3h. Gurmarin showed no effect or only a very weak effect on the sweet taste sensation in humans.
Reference: "High-resolution solution structure of gurmarin, a sweet-taste-suppressing plant polypeptide." Fletcher JI, Dingley AJ, Smith R, Connor M, Christie MJ, King GF. Eur. J. Biochem. 264 525-33 (1999)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Gymnema sylvestre Gurmarin
Recombinant Gymnema sylvestre Gurmarin
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P25810
Gene Names: N/A
Alternative Name(s): (Sweet taste-suppressing peptide)
Abbreviation: Recombinant Gymnema sylvestre Gurmarin protein
Organism: Gymnema sylvestre (Gurmar) (Periploca sylvestris)
Source: E.coli
Expression Region: 1-35aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: QQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG
MW: 19.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Suppresses strongly the sweet taste responses in the rat with high specificity to sucrose, glucose, glycine, and saccharin. This effect is reversible, but complete recovery of the suppressed responses required at least 3h. Gurmarin showed no effect or only a very weak effect on the sweet taste sensation in humans.
Reference: "High-resolution solution structure of gurmarin, a sweet-taste-suppressing plant polypeptide." Fletcher JI, Dingley AJ, Smith R, Connor M, Christie MJ, King GF. Eur. J. Biochem. 264 525-33 (1999)
Function:
Original: $898.01
-70%$898.01
$269.40Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P25810
Gene Names: N/A
Alternative Name(s): (Sweet taste-suppressing peptide)
Abbreviation: Recombinant Gymnema sylvestre Gurmarin protein
Organism: Gymnema sylvestre (Gurmar) (Periploca sylvestris)
Source: E.coli
Expression Region: 1-35aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: QQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG
MW: 19.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Suppresses strongly the sweet taste responses in the rat with high specificity to sucrose, glucose, glycine, and saccharin. This effect is reversible, but complete recovery of the suppressed responses required at least 3h. Gurmarin showed no effect or only a very weak effect on the sweet taste sensation in humans.
Reference: "High-resolution solution structure of gurmarin, a sweet-taste-suppressing plant polypeptide." Fletcher JI, Dingley AJ, Smith R, Connor M, Christie MJ, King GF. Eur. J. Biochem. 264 525-33 (1999)
Function:











