HomeStore

Recombinant Escherichia coli Colicin-Ia (cia), partial

Product image 1

Recombinant Escherichia coli Colicin-Ia (cia), partial

Recombinant Escherichia coli Colicin-Ia (cia), partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P06716

Gene Names: cia

Alternative Name(s):

Abbreviation: Recombinant E.coli cia protein, partial

Organism: Escherichia coli

Source: E.coli

Expression Region: 282-385aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: KNTPDGKTIVSPEKFPGRSSTNHSIVVSGDPRFAGTIKITTSAVIDNRANLNYLLSHSGLDYKRNILNDRNPVVTEDVEGDKKIYNAEVAEWDKLRQRLLDARN

MW: 15.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: This colicin is a channel-forming colicin. This class of transmembrane toxins depolarize the cytoplasmic membrane, leading to dissipation of cellular energy.; Colicins are polypeptide toxins produced by and active against E.coli and closely related bacteria.

Reference: "Structure of colicin I receptor bound to the R-domain of colicin Ia: implications for protein import." Buchanan S.K., Lukacik P., Grizot S., Ghirlando R., Ali M.M., Barnard T.J., Jakes K.S., Kienker P.K., Esser L. EMBO J 26: 2594-2604(2007)

Function:

$185.85

Original: $619.51

-70%
Recombinant Escherichia coli Colicin-Ia (cia), partial

$619.51

$185.85

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P06716

Gene Names: cia

Alternative Name(s):

Abbreviation: Recombinant E.coli cia protein, partial

Organism: Escherichia coli

Source: E.coli

Expression Region: 282-385aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: KNTPDGKTIVSPEKFPGRSSTNHSIVVSGDPRFAGTIKITTSAVIDNRANLNYLLSHSGLDYKRNILNDRNPVVTEDVEGDKKIYNAEVAEWDKLRQRLLDARN

MW: 15.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: This colicin is a channel-forming colicin. This class of transmembrane toxins depolarize the cytoplasmic membrane, leading to dissipation of cellular energy.; Colicins are polypeptide toxins produced by and active against E.coli and closely related bacteria.

Reference: "Structure of colicin I receptor bound to the R-domain of colicin Ia: implications for protein import." Buchanan S.K., Lukacik P., Grizot S., Ghirlando R., Ali M.M., Barnard T.J., Jakes K.S., Kienker P.K., Esser L. EMBO J 26: 2594-2604(2007)

Function: