Recombinant Erwinia amylovora Virulence membrane protein pagC (pagC)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: D4HWE3
Gene Names: pagC
Alternative Name(s):
Abbreviation: Recombinant Erwinia amylovora pagC protein
Organism: Erwinia amylovora (strain CFBP1430)
Source: E.coli
Expression Region: 24-185aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: DSHALSIGYAQSRVQDFNNLRGVNVKYRYEPESLLGVITSFSYMSAGGNVFDSSSWEDTYYDDSVKVKYFSLLVGPAYRINKHVSLYAVGGISNGKSALTQNYRHSNYTYTENSTDNTTSLAYGAGVQINPLENIVLDISYEGSKLQQTKINGFSMGIGYHF
MW: 25.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference: "Complete genome sequence of the fire blight pathogen Erwinia amylovora CFBP 1430 and comparison to other Erwinia spp." Smits T.H., Rezzonico F., Kamber T., Blom J., Goesmann A., Frey J.E., Duffy B. Mol. Plant Microbe Interact. 23: 384-393(2010)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Erwinia amylovora Virulence membrane protein pagC (pagC)
Recombinant Erwinia amylovora Virulence membrane protein pagC (pagC)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: D4HWE3
Gene Names: pagC
Alternative Name(s):
Abbreviation: Recombinant Erwinia amylovora pagC protein
Organism: Erwinia amylovora (strain CFBP1430)
Source: E.coli
Expression Region: 24-185aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: DSHALSIGYAQSRVQDFNNLRGVNVKYRYEPESLLGVITSFSYMSAGGNVFDSSSWEDTYYDDSVKVKYFSLLVGPAYRINKHVSLYAVGGISNGKSALTQNYRHSNYTYTENSTDNTTSLAYGAGVQINPLENIVLDISYEGSKLQQTKINGFSMGIGYHF
MW: 25.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference: "Complete genome sequence of the fire blight pathogen Erwinia amylovora CFBP 1430 and comparison to other Erwinia spp." Smits T.H., Rezzonico F., Kamber T., Blom J., Goesmann A., Frey J.E., Duffy B. Mol. Plant Microbe Interact. 23: 384-393(2010)
Function:
Original: $619.51
-70%$619.51
$185.85Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: D4HWE3
Gene Names: pagC
Alternative Name(s):
Abbreviation: Recombinant Erwinia amylovora pagC protein
Organism: Erwinia amylovora (strain CFBP1430)
Source: E.coli
Expression Region: 24-185aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: DSHALSIGYAQSRVQDFNNLRGVNVKYRYEPESLLGVITSFSYMSAGGNVFDSSSWEDTYYDDSVKVKYFSLLVGPAYRINKHVSLYAVGGISNGKSALTQNYRHSNYTYTENSTDNTTSLAYGAGVQINPLENIVLDISYEGSKLQQTKINGFSMGIGYHF
MW: 25.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference: "Complete genome sequence of the fire blight pathogen Erwinia amylovora CFBP 1430 and comparison to other Erwinia spp." Smits T.H., Rezzonico F., Kamber T., Blom J., Goesmann A., Frey J.E., Duffy B. Mol. Plant Microbe Interact. 23: 384-393(2010)
Function:











