Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Microbiology
Uniprot ID: P69538
Gene Names: IX
Alternative Name(s): Coat protein C, polypeptide II G9P
Abbreviation: Recombinant Enterobacteria phage M13 Tail virion protein G9P
Organism: Enterobacteria phage M13 (Bacteriophage M13)
Source: E.coli
Expression Region: 1-32aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
MW: 19.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Reference: "Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd."van Wezenbeek P.M.G.F., Hulsebos T.J.M., Schoenmakers J.G.G.Gene 11: 129-148(1980)
Function: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX)
Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Microbiology
Uniprot ID: P69538
Gene Names: IX
Alternative Name(s): Coat protein C, polypeptide II G9P
Abbreviation: Recombinant Enterobacteria phage M13 Tail virion protein G9P
Organism: Enterobacteria phage M13 (Bacteriophage M13)
Source: E.coli
Expression Region: 1-32aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
MW: 19.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Reference: "Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd."van Wezenbeek P.M.G.F., Hulsebos T.J.M., Schoenmakers J.G.G.Gene 11: 129-148(1980)
Function: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Microbiology
Uniprot ID: P69538
Gene Names: IX
Alternative Name(s): Coat protein C, polypeptide II G9P
Abbreviation: Recombinant Enterobacteria phage M13 Tail virion protein G9P
Organism: Enterobacteria phage M13 (Bacteriophage M13)
Source: E.coli
Expression Region: 1-32aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
MW: 19.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Reference: "Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd."van Wezenbeek P.M.G.F., Hulsebos T.J.M., Schoenmakers J.G.G.Gene 11: 129-148(1980)
Function: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
