HomeStore

Recombinant Dendroaspis angusticeps Dendrotoxin B, partial

Product image 1

Recombinant Dendroaspis angusticeps Dendrotoxin B, partial

Recombinant Dendroaspis angusticeps Dendrotoxin B, partial

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9PS09

Gene Names: N/A

Alternative Name(s): (DTX-B)

Abbreviation: Recombinant Dendroaspis angusticeps Dendrotoxin B protein, partial

Organism: Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Source: Mammalian cell

Expression Region: 1-30aa

Protein Length: Partial

Tag Info: C-terminal hFc1-tagged

Target Protein Sequence: MICYSHKTPQPSATIGCEEKTCYKKSVRKL

MW: 32.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Blocks voltage-gated potassium channels (Kv). This is the slowly inactivating phase of potassium efflux which is blocked by this toxin.

Reference: "Purification and partial characterization of K+ channel blockers from the venom of Dendroaspis angusticeps." Chaki S., Muramatsu M., Ushiyama Y., Otomo S. Neurochem. Int. 20: 553-558(1992)

Function:

$292.71
Recombinant Dendroaspis angusticeps Dendrotoxin B, partial
$292.71

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9PS09

Gene Names: N/A

Alternative Name(s): (DTX-B)

Abbreviation: Recombinant Dendroaspis angusticeps Dendrotoxin B protein, partial

Organism: Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Source: Mammalian cell

Expression Region: 1-30aa

Protein Length: Partial

Tag Info: C-terminal hFc1-tagged

Target Protein Sequence: MICYSHKTPQPSATIGCEEKTCYKKSVRKL

MW: 32.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Blocks voltage-gated potassium channels (Kv). This is the slowly inactivating phase of potassium efflux which is blocked by this toxin.

Reference: "Purification and partial characterization of K+ channel blockers from the venom of Dendroaspis angusticeps." Chaki S., Muramatsu M., Ushiyama Y., Otomo S. Neurochem. Int. 20: 553-558(1992)

Function: