Recombinant Conus radiatus Iota-conotoxin-like r11c
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q7Z096
Gene Names: N/A
Alternative Name(s): R11.4
Abbreviation: Recombinant Conus radiatus Iota-conotoxin-like r11c protein
Organism: Conus radiatus (Rayed cone)
Source: Yeast
Expression Region: 37-79aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-sumostar-tagged
Target Protein Sequence: GPSFCKADEKPCKYHADCCNCCLGGICKPSTSWIGCSTNVFLT
MW: 17.7 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Iota-conotoxins bind to voltage-gated sodium channels (Nav) and act as agonists by shifting the voltage-dependence of activation to more hyperpolarized levels. Causes circular motion, convulsions, copious urination, rigid paralysis and death upon intracranial injection into mice. Causes unbalanced swimming, swimming in diagonal and vertical motion and death, when injected intraperitoneally into goldfish. L-Leu and D-Leu forms are active on both nerve and muscle.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Conus radiatus Iota-conotoxin-like r11c
Recombinant Conus radiatus Iota-conotoxin-like r11c
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q7Z096
Gene Names: N/A
Alternative Name(s): R11.4
Abbreviation: Recombinant Conus radiatus Iota-conotoxin-like r11c protein
Organism: Conus radiatus (Rayed cone)
Source: Yeast
Expression Region: 37-79aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-sumostar-tagged
Target Protein Sequence: GPSFCKADEKPCKYHADCCNCCLGGICKPSTSWIGCSTNVFLT
MW: 17.7 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Iota-conotoxins bind to voltage-gated sodium channels (Nav) and act as agonists by shifting the voltage-dependence of activation to more hyperpolarized levels. Causes circular motion, convulsions, copious urination, rigid paralysis and death upon intracranial injection into mice. Causes unbalanced swimming, swimming in diagonal and vertical motion and death, when injected intraperitoneally into goldfish. L-Leu and D-Leu forms are active on both nerve and muscle.
Reference:
Function:
Original: $102,532.46
-70%$102,532.46
$30,759.74Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q7Z096
Gene Names: N/A
Alternative Name(s): R11.4
Abbreviation: Recombinant Conus radiatus Iota-conotoxin-like r11c protein
Organism: Conus radiatus (Rayed cone)
Source: Yeast
Expression Region: 37-79aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-sumostar-tagged
Target Protein Sequence: GPSFCKADEKPCKYHADCCNCCLGGICKPSTSWIGCSTNVFLT
MW: 17.7 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Iota-conotoxins bind to voltage-gated sodium channels (Nav) and act as agonists by shifting the voltage-dependence of activation to more hyperpolarized levels. Causes circular motion, convulsions, copious urination, rigid paralysis and death upon intracranial injection into mice. Causes unbalanced swimming, swimming in diagonal and vertical motion and death, when injected intraperitoneally into goldfish. L-Leu and D-Leu forms are active on both nerve and muscle.
Reference:
Function:











