Recombinant Chicken Pro-epidermal growth factor (EGF), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q6PPB4
Gene Names: EGF
Alternative Name(s):
Abbreviation: Recombinant Chicken EGF protein, partial
Organism: Gallus gallus (Chicken)
Source: Yeast
Expression Region: 1026-1080aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: GDSIGCPPAYDSYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQQHA
MW: 8.2 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mannose-specific lectin. Shows agglutinating activity towards rabbit erythrocytes. However, it does not show agglutinating activity towards human erythrocytes. Has insecticidal activity against the cotton leafworm S.littoralis and the peach potato aphid M.persicae. Also displays antiviral activity and therefore may contribute to defense against infections.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Chicken Pro-epidermal growth factor (EGF), partial
Recombinant Chicken Pro-epidermal growth factor (EGF), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q6PPB4
Gene Names: EGF
Alternative Name(s):
Abbreviation: Recombinant Chicken EGF protein, partial
Organism: Gallus gallus (Chicken)
Source: Yeast
Expression Region: 1026-1080aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: GDSIGCPPAYDSYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQQHA
MW: 8.2 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mannose-specific lectin. Shows agglutinating activity towards rabbit erythrocytes. However, it does not show agglutinating activity towards human erythrocytes. Has insecticidal activity against the cotton leafworm S.littoralis and the peach potato aphid M.persicae. Also displays antiviral activity and therefore may contribute to defense against infections.
Reference:
Function:
Original: $399.22
-70%$399.22
$119.77Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q6PPB4
Gene Names: EGF
Alternative Name(s):
Abbreviation: Recombinant Chicken EGF protein, partial
Organism: Gallus gallus (Chicken)
Source: Yeast
Expression Region: 1026-1080aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: GDSIGCPPAYDSYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQQHA
MW: 8.2 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mannose-specific lectin. Shows agglutinating activity towards rabbit erythrocytes. However, it does not show agglutinating activity towards human erythrocytes. Has insecticidal activity against the cotton leafworm S.littoralis and the peach potato aphid M.persicae. Also displays antiviral activity and therefore may contribute to defense against infections.
Reference:
Function:











